ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags15g14 |
|---|---|
| Clone Library Name | barley_pub |
>RFC5_NEUCR (Q8X082) Probable activator 1 subunit 5 (Replication factor C| subunit 5) (Replication factor C5) Length = 352 Score = 32.7 bits (73), Expect = 1.0 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = -3 Query: 618 WEEEIYDVAKKIMEEPSPKQLYLIRRKIRKMIEHNVSPYFIFCHLVNEL 472 WE I +AK+IMEE +P ++ +R K+ ++ H + I L +L Sbjct: 251 WEALIGQIAKEIMEEHTPARILQVRAKLYDLLTHCIPATIILKTLTFKL 299
>GRN_CAVPO (P28797) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] (Fragment) Length = 591 Score = 32.3 bits (72), Expect = 1.3 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +3 Query: 375 CPE---ICILCTARFGSTPVPVHQCYSENLHPCP 467 CP+ C+L + +G P+P C S++LH CP Sbjct: 215 CPDDTTCCLLASGEYGCCPMPNAICCSDHLHCCP 248
>ELOA1_HUMAN (Q14241) Transcription elongation factor B polypeptide 3 (RNA| polymerase II transcription factor SIII subunit A1) (SIII p110) (Elongin A) (EloA) (Elongin 110 kDa subunit) Length = 772 Score = 32.0 bits (71), Expect = 1.8 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -3 Query: 603 YDVAKKIMEEPSPKQLYLIRRKIRKMIEHNVSPYFIFCHLVNELKRDRDEDFQN 442 Y V + ++E +P QLY I +IE + + CH + K +R E++++ Sbjct: 574 YSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCH--RDFKEERPEEYES 625
>GRN_RAT (P23785) Granulins precursor [Contains: Acrogranin; Granulin-1| (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B) (Epithelin-2); Granulin-4 (Granulin A) (Epithelin-1); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granulin-7 (Gran Length = 588 Score = 31.6 bits (70), Expect = 2.3 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +3 Query: 375 CPE---ICILCTARFGSTPVPVHQCYSENLHPCP 467 CP+ C L T ++G P+P C S++LH CP Sbjct: 213 CPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCP 246
>GRN_MOUSE (P28798) Granulins precursor (Proepithelin) (PEPI) (PC cell-derived| growth factor) (PCDGF) [Contains: Acrogranin; Granulin-1; Granulin-2; Granulin-3; Granulin-4; Granulin-5; Granulin-6; Granulin-7] Length = 589 Score = 31.6 bits (70), Expect = 2.3 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +3 Query: 375 CPE---ICILCTARFGSTPVPVHQCYSENLHPCP 467 CP+ C L T ++G P+P C S++LH CP Sbjct: 214 CPDDSTCCELPTGKYGCCPMPNAICCSDHLHCCP 247
>ELOA1_RAT (Q63187) Transcription elongation factor B polypeptide 3 (RNA| polymerase II transcription factor SIII subunit A) (SIII p110) (Elongin A) (EloA) (Elongin 110 kDa subunit) Length = 773 Score = 31.6 bits (70), Expect = 2.3 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -3 Query: 603 YDVAKKIMEEPSPKQLYLIRRKIRKMIEHNVSPYFIFCHLVNELKRDRDEDFQN 442 Y V + ++E +P QLY I +IE + + CH + K +R E++++ Sbjct: 573 YSVLEPVLERCTPDQLYRIEECNHVLIEETDQLWKVHCH--RDFKEERPEEYES 624
>ELOA1_MOUSE (Q8CB77) Transcription elongation factor B polypeptide 3 (RNA| polymerase II transcription factor SIII subunit A) (SIII p110) (Elongin A) (EloA) (Elongin 110 kDa subunit) Length = 773 Score = 31.6 bits (70), Expect = 2.3 Identities = 15/54 (27%), Positives = 28/54 (51%) Frame = -3 Query: 603 YDVAKKIMEEPSPKQLYLIRRKIRKMIEHNVSPYFIFCHLVNELKRDRDEDFQN 442 Y V + ++E +P QLY I +IE + + CH + K +R E++++ Sbjct: 573 YSVLEPVLERCTPDQLYRIEECNHVLIEETDQLWKVHCH--RDFKEERPEEYES 624
>TAF1_DROME (P51123) Transcription initiation factor TFIID subunit 1 (EC| 2.7.11.1) (Transcription initiation factor TFIID 230 kDa subunit) (TAFII-230) (TAFII250) (TBP-associated factor 230 kDa) (p230) Length = 2129 Score = 31.2 bits (69), Expect = 3.0 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -3 Query: 669 TWKASYPFTKDQPILTGWEEEIYDVAKKIMEEPSPKQLYL 550 TW + +P ++ I WE+E+ A+++ + P PK L L Sbjct: 500 TWYSLFPVENEELIYYKWEDEVIWDAQQVSKVPKPKVLTL 539
>YKYB_BACSU (P42430) Hypothetical protein ykyB| Length = 154 Score = 31.2 bits (69), Expect = 3.0 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = -3 Query: 654 YPFTKD-QPILTGWEEEIYDVAKKIMEEPSPKQLYLI-RRKIRKMIE 520 + +TKD QP + + +Y V + P+PK LYL+ +R ++K+++ Sbjct: 4 HAYTKDLQPTVENLSKAVYTVNRHAKTAPNPKYLYLLKKRALQKLVK 50
>GRN_HUMAN (P28799) Granulins precursor (Proepithelin) (PEPI) [Contains:| Acrogranin; Paragranulin; Granulin-1 (Granulin G); Granulin-2 (Granulin F); Granulin-3 (Granulin B); Granulin-4 (Granulin A); Granulin-5 (Granulin C); Granulin-6 (Granulin D); Granul Length = 593 Score = 30.8 bits (68), Expect = 3.9 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = +3 Query: 375 CPE---ICILCTARFGSTPVPVHQCYSENLHPCP 467 CP+ C L + ++G P+P C S++LH CP Sbjct: 215 CPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCP 248
>BNC1_MOUSE (O35914) Zinc finger protein basonuclin-1| Length = 961 Score = 30.0 bits (66), Expect = 6.7 Identities = 15/60 (25%), Positives = 27/60 (45%) Frame = -3 Query: 492 CHLVNELKRDRDEDFQNSIDELALELNQNEQCKEYKSQDTISDKRAINIEGFAVEGPDQG 313 C++V R R+ N L + +N+N + K+ ++ ++ GF V PD G Sbjct: 360 CNMVFSSLRSRNRHSANPNPRLHMPMNRNNRDKDLRNSLNLASSETYKRPGFTVVSPDCG 419
>TYSY_XANAC (Q8PP46) Thymidylate synthase (EC 2.1.1.45) (TS) (TSase)| Length = 264 Score = 29.6 bits (65), Expect = 8.7 Identities = 24/103 (23%), Positives = 42/103 (40%), Gaps = 11/103 (10%) Frame = -3 Query: 561 QLYLIRRKIRKMIEHNVSPYFIFCHLVNELKRDRDEDFQNSIDELALELNQNEQCKE--- 391 QLY I + N++ Y + H+V + DF +++ + L N EQ +E Sbjct: 162 QLYQRSGDIFLGVPFNIASYALLTHMVAQATGLGVGDFVHTLGDAHLYSNHFEQAREQLT 221 Query: 390 --------YKSQDTISDKRAINIEGFAVEGPDQGEAIQCFIRI 286 + ++D A E A+EG D AI+ + + Sbjct: 222 RTPRALPSLRLNPEVTDLFAFRFEDIAIEGYDPHPAIKAPVAV 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,551,477 Number of Sequences: 219361 Number of extensions: 1927146 Number of successful extensions: 5069 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 4942 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5069 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6598423128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
