| Clone Name | rbags15f24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | V2A_TAV (P29035) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (p... | 33 | 0.78 | 2 | V2A_CMVQ (P06012) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (... | 30 | 6.6 |
|---|
>V2A_TAV (P29035) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (protein 2A)| Length = 828 Score = 32.7 bits (73), Expect = 0.78 Identities = 27/87 (31%), Positives = 41/87 (47%) Frame = -1 Query: 264 RPPPASAAFHNKHICVSSVSARSEELYQIFLYCLSQ*AYIWFLVLFYVGCGFLLLSIVYF 85 RP PA+ FH K + S S L+Q F CL++ V+ VG L I F Sbjct: 459 RPLPATITFHRKQL-TSQFSPLFTALFQRFQRCLTK------RVILPVG-KISSLEIKDF 510 Query: 84 TAFS*AISGLDISRYFK*MGRMHLSMQ 4 + + +D+S++ K G +HL +Q Sbjct: 511 SVLNKFCLEIDLSKFDKSQGELHLMIQ 537
>V2A_CMVQ (P06012) RNA-directed RNA polymerase 2A (EC 2.7.7.48) (protein 2A)| Length = 839 Score = 29.6 bits (65), Expect = 6.6 Identities = 26/87 (29%), Positives = 39/87 (44%) Frame = -1 Query: 264 RPPPASAAFHNKHICVSSVSARSEELYQIFLYCLSQ*AYIWFLVLFYVGCGFLLLSIVYF 85 RP PA+ FH K I S S L++ F CL + V+ VG L + F Sbjct: 452 RPVPATITFHKKTI-TSQFSPLFISLFERFQRCLRE------RVVLPVG-KISSLEMTGF 503 Query: 84 TAFS*AISGLDISRYFK*MGRMHLSMQ 4 + + +D+S++ K G HL +Q Sbjct: 504 SVLNKHCLEIDLSKFDKSQGEFHLMIQ 530 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,473,331 Number of Sequences: 219361 Number of extensions: 1123667 Number of successful extensions: 2895 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2894 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)