| Clone Name | rbags15f16 |
|---|---|
| Clone Library Name | barley_pub |
>IF2_NITWN (Q3SWP9) Translation initiation factor IF-2| Length = 871 Score = 29.6 bits (65), Expect = 1.8 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 1/60 (1%) Frame = +3 Query: 63 DDGYFPITNWNTSEMLAHGKTETVSKIIAGKVIREPQCK-ERNHVQVQVHDQAADSL*GE 239 DDG P T E + H K V IIA I +P+ K ER ++ H+ +S+ G+ Sbjct: 452 DDGVMP----QTIEAINHAKAAKVPMIIAINKIDKPEAKPERVRTELLQHEVQVESMGGQ 507
>UL52_HCMVA (P16793) Probable major envelope glycoprotein UL52 (HFRF1 protein)| Length = 668 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 149 CYDLRNRFCFSMSKHFRCIPVCNGEITIINKS 54 C+ LR + KHF C P C G I + N++ Sbjct: 553 CHVLRQAGVTGIYKHFFCDPQCAGNIRVTNEA 584
>RTXC_VIBCH (Q9X4W3) Cytolysin-activating lysine-acyltransferase rtxC (EC| 2.3.1.-) Length = 153 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 176 ALWLXNHFPCYDLRNRFCFSMSKHFRCIPVCN 81 A WL P ++L N+FC+ +H R I CN Sbjct: 38 AEWLQRILPAFEL-NQFCYYEDEHGRPIAFCN 68
>PHEA_PSEUE (P31020) Phenol 2-monooxygenase (EC 1.14.13.7) (Phenol hydroxylase)| Length = 607 Score = 28.5 bits (62), Expect = 4.1 Identities = 22/77 (28%), Positives = 31/77 (40%), Gaps = 5/77 (6%) Frame = +3 Query: 90 WNTSEMLAHGKTETVSKIIAGKVIREPQCKERNHVQVQVHDQAADSL*GEETGCRPTHGG 269 W + AH + +I+ I + E ++ +S+ GEE G RPT G Sbjct: 69 WTANTPRAHITNQRTMEILRDAGIEDQVLAEAVPHELMGDTVYCESMAGEEIGRRPTWGT 128 Query: 270 HP--VASY---PPGMPC 305 P A Y P MPC Sbjct: 129 RPDRRADYELASPAMPC 145
>NPRM_BACME (Q00891) Bacillolysin precursor (EC 3.4.24.28) (Neutral protease)| Length = 562 Score = 28.5 bits (62), Expect = 4.1 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +3 Query: 72 YFPITNWNTSEMLAHGKTETVSKIIAGKVIREPQCKERNHVQVQVHDQAADSL*GEETGC 251 Y I W +++ LAH + K+++G V + KE+ Q QV + A ++ G Sbjct: 110 YNNIPVWGSTQ-LAHVAKDGTLKVVSGTVAPDLDKKEKLKGQKQVDSKKAIQAAEKDLGF 168 Query: 252 RPTHGGHP 275 +PT+ P Sbjct: 169 KPTYEKSP 176
>TSC1_RAT (Q9Z136) Hamartin (Tuberous sclerosis 1 protein homolog)| Length = 1163 Score = 28.1 bits (61), Expect = 5.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 234 GEETGCRPTHGGHPVASYPPGMPCRSHQC 320 G TG + T G P S PP PC C Sbjct: 378 GTTTGGKGTPSGTPATSPPPAPPCPQDDC 406
>LSHB_MACFA (Q6EV78) Lutropin beta chain precursor (Luteinizing hormone beta| subunit) (LSH-beta) (LSH-B) (LH-B) Length = 141 Score = 27.7 bits (60), Expect = 7.0 Identities = 22/76 (28%), Positives = 34/76 (44%) Frame = +3 Query: 93 NTSEMLAHGKTETVSKIIAGKVIREPQCKERNHVQVQVHDQAADSL*GEETGCRPTHGGH 272 NTS + G T+ +++ ++ PQ V H+ DS+ + GC P G Sbjct: 50 NTS--ICAGYCPTMMRVLQAALLPLPQ------VVCTYHEVRFDSI--QLPGCLP--GVD 97 Query: 273 PVASYPPGMPCRSHQC 320 PV S+P + CR C Sbjct: 98 PVVSFPVALSCRCGPC 113
>YCLC_BACSU (P94405) Hypothetical protein yclC| Length = 473 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -2 Query: 294 LEDMKQLGALHE*VGIQSLLPKGCQQLGHEPEPEHDYVL 178 LED G + VGI + KG +LG +P P+HD + Sbjct: 150 LEDPDNFGKQN--VGIYRMQVKGKDRLGIQPVPQHDIAI 186
>GRASP_RAT (Q8R4T5) General receptor for phosphoinositides 1-associated| scaffold protein (GRP1-associated scaffold protein) (Tamalin) (95 kDa postsynaptic density protein discs-large ZO-1 domain-containing protein) (PSD-95 PDZ domain-containing protein) Length = 394 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/48 (35%), Positives = 22/48 (45%) Frame = +3 Query: 159 IREPQCKERNHVQVQVHDQAADSL*GEETGCRPTHGGHPVASYPPGMP 302 +R+ Q KE + +A DS E PT G P A+ PPG P Sbjct: 6 LRKLQQKEEATAAPDLAGRAPDS---EAARAAPTPSGPPAAAAPPGAP 50 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,448,748 Number of Sequences: 219361 Number of extensions: 864491 Number of successful extensions: 2039 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1982 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2038 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)