| Clone Name | rbags15e21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RR31_SPIOL (P47910) 30S ribosomal protein S31, chloroplast (Frag... | 35 | 0.20 | 2 | GAL4_YEAST (P04386) Regulatory protein GAL4 | 34 | 0.45 | 3 | SYFB_DESVH (Q728S0) Phenylalanyl-tRNA synthetase beta chain (EC ... | 31 | 3.8 |
|---|
>RR31_SPIOL (P47910) 30S ribosomal protein S31, chloroplast (Fragment)| Length = 43 Score = 35.0 bits (79), Expect = 0.20 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -1 Query: 504 FSHSYGNARPRNKKKGTG 451 F+HS+GNARP+NK KG G Sbjct: 13 FNHSFGNARPKNKNKGRG 30
>GAL4_YEAST (P04386) Regulatory protein GAL4| Length = 881 Score = 33.9 bits (76), Expect = 0.45 Identities = 23/76 (30%), Positives = 38/76 (50%) Frame = +3 Query: 411 PSLEALEGRKAVLGLFPSSCYGAVHFHMSG*TFCLSLSFCPLFHSRLVKGETILKSQAET 590 P L + ++++ L PS+ +G +F+ SG SLSF + G ++ +Q + Sbjct: 745 PFLGQQQQLQSLVPLTPSALFGGANFNQSGNIADSSLSFT---FTNSSNGPNLITTQTNS 801 Query: 591 ILKSQLVQSSNVHPIF 638 SQ + SSNVH F Sbjct: 802 QALSQPIASSNVHDNF 817
>SYFB_DESVH (Q728S0) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 798 Score = 30.8 bits (68), Expect = 3.8 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +3 Query: 522 SFCPLFHSRLVKGETILKSQAETILKSQLVQSSNVHPIFNI 644 S CPLFH R+++G + KS A ++ +L+ + V PI NI Sbjct: 213 SLCPLFHGRVLEGAAVRKSPA--WMRYRLI-AVGVRPISNI 250 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,069,036 Number of Sequences: 219361 Number of extensions: 1714817 Number of successful extensions: 3804 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3804 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6484657212 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)