| Clone Name | rbags15d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZNF8_HUMAN (P17098) Zinc finger protein 8 (Zinc finger protein H... | 31 | 3.5 | 2 | APC_MOUSE (Q61315) Adenomatous polyposis coli protein (Protein A... | 30 | 6.0 | 3 | BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-assoc... | 30 | 7.8 | 4 | BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associa... | 30 | 7.8 |
|---|
>ZNF8_HUMAN (P17098) Zinc finger protein 8 (Zinc finger protein HF.18)| Length = 575 Score = 30.8 bits (68), Expect = 3.5 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 4/55 (7%) Frame = -1 Query: 475 TRGSFPKEEPLSPNRAAEEEEGINRSIDNKPLHILHRAG----QPIKTLRGPDTE 323 T+G P EP S ++A+ +EEG+ + +P H+ R G P T G D E Sbjct: 91 TQGCHPAWEPRSESQASRKEEGLP---EEEPSHVTGREGFPTDAPYPTTLGKDRE 142
>APC_MOUSE (Q61315) Adenomatous polyposis coli protein (Protein APC) (mAPC)| Length = 2845 Score = 30.0 bits (66), Expect = 6.0 Identities = 22/81 (27%), Positives = 37/81 (45%), Gaps = 1/81 (1%) Frame = -1 Query: 619 LISAKEHKSPEN*GRCQ*HTNAGQICASEQFEAIRKGQESHQF*RHMNTRGSFPKEEPLS 440 L KE K E C+ N+ Q AS+ +I+ Q + + +FP+ Sbjct: 1879 LRKGKESKDSEAKVTCRPEPNSSQQAASKSQASIKHPANRAQSKPVLQKQPTFPQSSKDG 1938 Query: 439 PNRAAEEEEGI-NRSIDNKPL 380 P+R A +E + N +I+N P+ Sbjct: 1939 PDRGAATDEKLQNLAIENTPV 1959
>BAT2_HUMAN (P48634) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2157 Score = 29.6 bits (65), Expect = 7.8 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -1 Query: 484 HMNTRGSFPKEEPLSPNR-AAEEEEGINRSIDNKPLHILHRAGQPIK 347 H R P+E+PL P E + +R + P+ HR G P++ Sbjct: 1715 HDGDRKELPREQPLPPGPIGTERSQRTDRGTEPGPIRPSHRPGPPVQ 1761
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 29.6 bits (65), Expect = 7.8 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -1 Query: 484 HMNTRGSFPKEEPLSPNR-AAEEEEGINRSIDNKPLHILHRAGQPIK 347 H R P+E+PL P E + +R + PL HRAG ++ Sbjct: 1718 HEGERKELPREQPLPPGPIGTERSQRTDRGPEPGPLRPAHRAGSQVE 1764 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,811,551 Number of Sequences: 219361 Number of extensions: 2005468 Number of successful extensions: 4125 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3999 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4125 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)