| Clone Name | rbags14m14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EGFL9_HUMAN (Q6UY11) EGF-like domain-containing protein 9 precur... | 31 | 3.3 | 2 | EGFL9_MOUSE (Q8K1E3) EGF-like domain-containing protein 9 precur... | 31 | 3.3 | 3 | YLK2_CAEEL (P41950) Hypothetical protein D1044.2 precursor | 29 | 9.5 |
|---|
>EGFL9_HUMAN (Q6UY11) EGF-like domain-containing protein 9 precursor (Multiple| EGF-like domain protein 9) Length = 383 Score = 30.8 bits (68), Expect = 3.3 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +2 Query: 209 LQQGCLMPENHTTRLHAKNEYIYCTMVPKCIRISQTSHGRCYLAWMCL 352 L GC P+ + R E ++C +C+R+ HG C+ W C+ Sbjct: 35 LAHGCCAPDG-SCRCDPGWEGLHCE---RCVRMPGCQHGTCHQPWQCI 78
>EGFL9_MOUSE (Q8K1E3) EGF-like domain-containing protein 9 precursor (Multiple| EGF-like domain protein 9) (Endothelial cell-specific protein S-1) Length = 382 Score = 30.8 bits (68), Expect = 3.3 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = +2 Query: 209 LQQGCLMPENHTTRLHAKNEYIYCTMVPKCIRISQTSHGRCYLAWMCL 352 L GC P+ + R E ++C +C+R+ HG C+ W C+ Sbjct: 35 LAHGCCAPDG-SCRCDPGWEGLHCE---RCVRMPGCQHGTCHQPWQCI 78
>YLK2_CAEEL (P41950) Hypothetical protein D1044.2 precursor| Length = 1090 Score = 29.3 bits (64), Expect = 9.5 Identities = 16/62 (25%), Positives = 23/62 (37%) Frame = +1 Query: 166 CLCKGRHEGHGMNNTATGVLDAGKSHHQTARKE*VYILYNGAKMYKDQSNQSWQMLSSLD 345 C+CK G G N+ + L +HHQ RK+ S W + L Sbjct: 435 CMCKEGFSGDGQNDCSQSFLFQYDTHHQLPRKK--------------NSKMEWNLKKPLK 480 Query: 346 VF 351 +F Sbjct: 481 IF 482 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,156,728 Number of Sequences: 219361 Number of extensions: 1852460 Number of successful extensions: 3581 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3581 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)