| Clone Name | rbags14k24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COCA1_HUMAN (Q99715) Collagen alpha-1(XII) chain precursor | 35 | 0.22 | 2 | ATP11_SCHPO (P87127) Protein atp11, mitochondrial precursor | 34 | 0.37 | 3 | COCA1_MOUSE (Q60847) Collagen alpha-1(XII) chain precursor | 30 | 5.4 | 4 | RPOC_DECAR (Q47JA9) DNA-directed RNA polymerase beta' chain (EC ... | 30 | 5.4 | 5 | HSP1_TRAPL (Q7JHM9) Sperm protamine P1 | 30 | 7.1 | 6 | HSP1_TRAPH (Q8MHZ2) Sperm protamine P1 | 30 | 7.1 | 7 | HSP1_TRAOB (Q7JIX9) Sperm protamine P1 | 30 | 7.1 | 8 | HSP1_TRAGE (Q7JHM8) Sperm protamine P1 | 30 | 7.1 | 9 | HSP1_TRAFR (Q9GKQ4) Sperm protamine P1 | 30 | 7.1 | 10 | HSP1_TRACR (Q9GKQ2) Sperm protamine P1 | 30 | 7.1 | 11 | PHX2A_RAT (Q62782) Paired mesoderm homeobox protein 2A (Paired-l... | 30 | 7.1 |
|---|
>COCA1_HUMAN (Q99715) Collagen alpha-1(XII) chain precursor| Length = 3063 Score = 35.0 bits (79), Expect = 0.22 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 279 TTATTKMGWGGGRGRVKELIVSFSAVASG 365 TT+T K+ W G G+VK+ +V+++ VA G Sbjct: 826 TTSTMKLSWSGAPGKVKQYLVTYTPVAGG 854
>ATP11_SCHPO (P87127) Protein atp11, mitochondrial precursor| Length = 286 Score = 34.3 bits (77), Expect = 0.37 Identities = 26/97 (26%), Positives = 43/97 (44%), Gaps = 7/97 (7%) Frame = -2 Query: 696 TGLEDYKARGTQASPYCTVTHFTEFAETKDTVLVRGDVVFTSKLTDAEAKCLLETAHSFY 517 T L +YK +G+ A+P+ + HF + K L+R KL+ + + L+ FY Sbjct: 190 TSLLEYKLKGSYAAPHTIMLHFADLLNLKGITLMRCQFE-PKKLSANDVQLLVLAIQKFY 248 Query: 516 -------LNDVRYKLVERFNKETRDFEFKDVLQALEM 427 L R L+ F+K DF+ V ++M Sbjct: 249 NASENTPLGKERLALLAAFSKGA-DFDLHKVATHMDM 284
>COCA1_MOUSE (Q60847) Collagen alpha-1(XII) chain precursor| Length = 3119 Score = 30.4 bits (67), Expect = 5.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +3 Query: 279 TTATTKMGWGGGRGRVKELIVSFSAVASG 365 TT+T K+ W G+VK+ +V+++ A G Sbjct: 830 TTSTLKLSWSRAPGKVKQYLVTYTPAAGG 858
>RPOC_DECAR (Q47JA9) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1403 Score = 30.4 bits (67), Expect = 5.4 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 1/73 (1%) Frame = -1 Query: 544 SFRDSTLVLPERCAVQARGAFQQGNTRFRVQRR-PSGA*NAVHVSRDVKPSCDD*ASQHG 368 SF+++T VL E + R + V R P+G A H SR + + +D A+ Sbjct: 1327 SFQETTRVLTEAAIMGKRDELRGLKENVIVGRLIPAGTGLAFHRSRKAQLAGEDIAASRQ 1386 Query: 367 EPEATAENETMSS 329 EATAEN T + Sbjct: 1387 IEEATAENTTQEA 1399
>HSP1_TRAPL (Q7JHM9) Sperm protamine P1| Length = 50 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 631 HRVCRNQGYSAC--PRRRCLHQQTNRCR 554 +R CR+Q S C PRRRC ++ CR Sbjct: 3 YRCCRSQSRSRCCRPRRRCRRRRRRSCR 30
>HSP1_TRAPH (Q8MHZ2) Sperm protamine P1| Length = 49 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 631 HRVCRNQGYSAC--PRRRCLHQQTNRCR 554 +R CR+Q S C PRRRC ++ CR Sbjct: 3 YRCCRSQSRSRCCRPRRRCRRRRRRSCR 30
>HSP1_TRAOB (Q7JIX9) Sperm protamine P1| Length = 50 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 631 HRVCRNQGYSAC--PRRRCLHQQTNRCR 554 +R CR+Q S C PRRRC ++ CR Sbjct: 3 YRCCRSQSRSRCCRPRRRCRRRRRRSCR 30
>HSP1_TRAGE (Q7JHM8) Sperm protamine P1| Length = 50 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 631 HRVCRNQGYSAC--PRRRCLHQQTNRCR 554 +R CR+Q S C PRRRC ++ CR Sbjct: 3 YRCCRSQSRSRCCRPRRRCRRRRRRSCR 30
>HSP1_TRAFR (Q9GKQ4) Sperm protamine P1| Length = 50 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 631 HRVCRNQGYSAC--PRRRCLHQQTNRCR 554 +R CR+Q S C PRRRC ++ CR Sbjct: 3 YRCCRSQSRSRCCRPRRRCRRRRRRSCR 30
>HSP1_TRACR (Q9GKQ2) Sperm protamine P1| Length = 50 Score = 30.0 bits (66), Expect = 7.1 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -1 Query: 631 HRVCRNQGYSAC--PRRRCLHQQTNRCR 554 +R CR+Q S C PRRRC ++ CR Sbjct: 3 YRCCRSQSRSRCCRPRRRCRRRRRRSCR 30
>PHX2A_RAT (Q62782) Paired mesoderm homeobox protein 2A (Paired-like homeobox| 2A) (Aristaless homeobox protein homolog) (ARIX1 homeodomain protein) Length = 281 Score = 30.0 bits (66), Expect = 7.1 Identities = 20/75 (26%), Positives = 30/75 (40%) Frame = -1 Query: 484 FQQGNTRFRVQRRPSGA*NAVHVSRDVKPSCDD*ASQHGEPEATAENETMSSFTLPLPPP 305 FQ +FR Q R + A A + K + E+T + S+ +LP PPP Sbjct: 138 FQNRRAKFRKQERAATAKGAAGATGAKKGEARCSSEDDDSKESTCSHTPDSTASLPPPPP 197 Query: 304 HPIFVVAVVSRKTTP 260 P ++S P Sbjct: 198 APSLASPLLSPSPLP 212 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,062,730 Number of Sequences: 219361 Number of extensions: 2042866 Number of successful extensions: 5524 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 5273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5514 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)