| Clone Name | rbags14i17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATU2_YEAST (P38995) Copper-transporting ATPase (EC 3.6.3.4) (Cu(... | 32 | 1.2 | 2 | MCRS1_MOUSE (Q99L90) Microspherule protein 1 (58 kDa microspheru... | 31 | 3.4 | 3 | RPTN_MOUSE (P97347) Repetin | 30 | 5.7 | 4 | HOX1A_MAIZE (P46605) Homeobox protein HOX1A | 30 | 5.7 |
|---|
>ATU2_YEAST (P38995) Copper-transporting ATPase (EC 3.6.3.4) (Cu(2+)-ATPase)| Length = 1004 Score = 32.3 bits (72), Expect = 1.2 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +2 Query: 41 ERNRSQLTTCYNLQGTIE-RTVTHHDDTRTWQTTILMSTSLQVTLILLHPA*PFLW 205 ER + T NL T + R ++ D+ R W+ + ST L + +LL+ P +W Sbjct: 224 ERTGYKFTVFSNLDNTTQLRLLSKEDEIRFWKKNSIKSTLLAIICMLLYMIVPMMW 279
>MCRS1_MOUSE (Q99L90) Microspherule protein 1 (58 kDa microspherule protein)| Length = 462 Score = 30.8 bits (68), Expect = 3.4 Identities = 18/57 (31%), Positives = 28/57 (49%) Frame = -3 Query: 603 GNHRLNSPKIVGSPRRRSAGKNIPGLEHVDEARRKAILQELRRMKAAGR*SSQRCYG 433 G R +S + P+RRS+ + I + DE ++ + R+K AG S RC G Sbjct: 30 GQKRASSQALGTIPKRRSSSRFIKRKKFDDELVESSLAKSSTRVKGAGGVESGRCSG 86
>RPTN_MOUSE (P97347) Repetin| Length = 1130 Score = 30.0 bits (66), Expect = 5.7 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = +2 Query: 221 TSDSKCTQSEIQGSTGTGQR*AGLSTDELETDEAQQHGCQSSSPAAKQSRVQI 379 + S C QSEI + GQ L TD D +H +S + + SR ++ Sbjct: 854 SQSSHCGQSEIGKTENQGQNRHSLGTDRTRRDSYVEHSGRSGKLSQQNSREEV 906
>HOX1A_MAIZE (P46605) Homeobox protein HOX1A| Length = 719 Score = 30.0 bits (66), Expect = 5.7 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 573 VGSPRRRSAGKNIPGLEHVDEARRKAILQELRRMK 469 VG + SA PG + ++AR+KAI QELR+ K Sbjct: 682 VGGSKVDSAEDQNPGPDLAEKARQKAIQQELRKKK 716 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,165,273 Number of Sequences: 219361 Number of extensions: 1624182 Number of successful extensions: 3788 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3787 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)