| Clone Name | rbags14h01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | T2R46_MACMU (Q645T4) Taste receptor type 2 member 46 (T2R46) | 31 | 3.3 | 2 | FA5_PIG (Q9GLP1) Coagulation factor V precursor (Activated prote... | 30 | 9.7 |
|---|
>T2R46_MACMU (Q645T4) Taste receptor type 2 member 46 (T2R46)| Length = 308 Score = 31.2 bits (69), Expect = 3.3 Identities = 23/79 (29%), Positives = 39/79 (49%), Gaps = 2/79 (2%) Frame = +3 Query: 474 TFGEL*FLH-KNNTKAILLKTASVQVSSIQIMQIRVQNKGKRVWKSRYDGDLSTPPSLKP 650 TF L FLH K K+++L T + + + + V N VW+ Y+G+++ L+ Sbjct: 112 TFSNLIFLHLKRKVKSVILVTLLGPLLFL-VCHLFVMNMNHIVWRKEYEGNITWRIKLRS 170 Query: 651 CLSSSN-SVDKLREIKTLT 704 + SN +V L + LT Sbjct: 171 AMYLSNVTVTMLANLIPLT 189
>FA5_PIG (Q9GLP1) Coagulation factor V precursor (Activated protein C| cofactor) [Contains: Coagulation factor V heavy chain; Coagulation factor V light chain] Length = 2258 Score = 29.6 bits (65), Expect = 9.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 465 FTEIISGKYEKYLRKDPPDLRMASLWGP 382 F +I+ +YE Y +K+ P RM+ L GP Sbjct: 61 FKKIVYREYEAYFQKEKPPSRMSGLLGP 88 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,164,795 Number of Sequences: 219361 Number of extensions: 1919401 Number of successful extensions: 4932 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4931 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7366267610 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)