| Clone Name | rbags14g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YSS2_CAEEL (Q09991) Putative serine carboxypeptidase K10B2.2 pre... | 27 | 8.9 |
|---|
>YSS2_CAEEL (Q09991) Putative serine carboxypeptidase K10B2.2 precursor (EC| 3.4.16.-) Length = 470 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = -3 Query: 395 YHYAGIQDYLHKGGLKADXXXXXXXXXXPGAGHFIQQERAQEVSDHIYDFI 243 +HY+G Q G + G+GHF+ +++ +E I++FI Sbjct: 410 WHYSG-QTGTAVAGFQTKFAGNVDFLTVRGSGHFVPEDKPKESQQMIFNFI 459 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,119,190 Number of Sequences: 219361 Number of extensions: 658707 Number of successful extensions: 1432 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1429 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)