| Clone Name | rbags13p10 |
|---|---|
| Clone Library Name | barley_pub |
>TIP1_ARATH (Q52T38) Palmitoyltransferase TIP1 (EC 2.3.1.-) (Ankyrin| repeat-containing S-palmitoyltransferase) (Protein TIP GROWTH DEFECTIVE1) Length = 620 Score = 75.9 bits (185), Expect = 1e-13 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = -1 Query: 452 QIARNLTTNEAANQSRYTYLRGPDGRFRNPYNQDWQKNCGYFLVNGYNNDEE 297 QI+RN+TTNE AN RY+YLRGP GRFRNPY+ ++NC FLV GYN D E Sbjct: 486 QISRNITTNEMANALRYSYLRGPGGRFRNPYDLGCRRNCSDFLVKGYNEDIE 537
>MRKE_KLEPN (P21649) Protein mrkE| Length = 269 Score = 31.6 bits (70), Expect = 2.5 Identities = 15/52 (28%), Positives = 24/52 (46%) Frame = -1 Query: 629 TQAHDLYFACNTSNLAIWFIAREYLLSPILILPFVPDMLERPRRNTARLFIT 474 T HD+Y+A + + RE + P+ I FVPD L ++ +T Sbjct: 208 TSIHDIYYAEAHEKMTFVYTRRESFVMPMNITEFVPDALNIAASGQSKFLLT 259
>RNP4_METMP (P62378) Ribonuclease P protein component 4 (EC 3.1.26.5) (RNase P| component 4) Length = 110 Score = 30.8 bits (68), Expect = 4.2 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 6/56 (10%) Frame = -1 Query: 458 LMQIARNLTTNEAANQSRYTYLRGPD--GRFRNPYNQDWQ----KNCGYFLVNGYN 309 LM +A + + +S+ L G R R PY ++W+ KNCG FL+ G N Sbjct: 22 LMNLAEKESNSGKTERSKNYVLLGKKIAMRMRMPYPKEWKRRICKNCGSFLIYGKN 77
>CFAH_BOVIN (Q28085) Complement factor H (H factor 1) (Fragments)| Length = 685 Score = 30.4 bits (67), Expect = 5.5 Identities = 9/28 (32%), Positives = 19/28 (67%) Frame = +3 Query: 516 HIGDKWEYQYGTEQIFSCDEPYSKVGSV 599 H+ + +++YG + +++CDE Y VG + Sbjct: 22 HLAEGNQFEYGAKVVYTCDEGYQMVGEM 49
>RUVC_PSEPK (Q88NJ2) Crossover junction endodeoxyribonuclease ruvC (EC| 3.1.22.4) (Holliday junction nuclease ruvC) (Holliday juction resolvase ruvC) Length = 174 Score = 30.0 bits (66), Expect = 7.2 Identities = 16/53 (30%), Positives = 29/53 (54%) Frame = +1 Query: 451 CIKHG*VHVMKSLAVFRLGLSSISGTNGSINMGLSRYSLAMNHIARLEVLQAK 609 CI+ G + + L + G+S I +G + MG+ R +A N + L++ QA+ Sbjct: 33 CIRTGSGELHERLQIVFRGVSEIIAQHGPVTMGIERVFMARNADSALKLGQAR 85
>ZDH12_RAT (Q6DGF5) Probable palmitoyltransferase ZDHHC12 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 12) (DHHC-12) Length = 267 Score = 29.6 bits (65), Expect = 9.4 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = -1 Query: 458 LMQIARNLTTNEAANQSRYTYLRGPDGRFRNPYNQDWQKNCGYFLVNGYNNDEEAAW 288 L +ARN TT E + R YLR R NP+++ +N +F + E W Sbjct: 202 LYLVARNTTTWEFISSHRIAYLR---QRTSNPFDRGPTRNLAHFFCGWPSGPWETLW 255
>TRZA_RHOCO (Q52725) S-triazine hydrolase (EC 3.8.1.-) (N-ethylammeline| chlorohydrolase) Length = 476 Score = 29.6 bits (65), Expect = 9.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -2 Query: 616 TCILPATLPTLLYGSSQENICSVPY*YSHLSPI 518 TC +PA+LPT S E+ C+ P + SP+ Sbjct: 88 TCSIPASLPTQTTTSESEHCCTAPKPFVLASPL 120 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,737,981 Number of Sequences: 219361 Number of extensions: 2191787 Number of successful extensions: 5039 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5039 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)