| Clone Name | rbags14d19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RX_DROME (Q9W2Q1) Retinal homeobox protein Rx (DRx1) (DRx) | 30 | 5.2 | 2 | R1_ARATH (Q9SAC6) Alpha-glucan water dikinase, chloroplast precu... | 30 | 6.8 |
|---|
>RX_DROME (Q9W2Q1) Retinal homeobox protein Rx (DRx1) (DRx)| Length = 873 Score = 30.4 bits (67), Expect = 5.2 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = -3 Query: 319 IFSSSLHS*SCNTAVHVQHVAQQSILLYWMINMGGGEELMPPRGLIKASHLFRFSDDA 146 + +SS + + NTA QH+ +Q ++ GGG +PP+ L + HL DA Sbjct: 7 VANSSSTAAANNTAATFQHIFEQ------LVQQGGGNHKLPPKQLEQLRHLLGNVRDA 58
>R1_ARATH (Q9SAC6) Alpha-glucan water dikinase, chloroplast precursor (EC| 2.7.9.4) (Starch-related R1 protein) (Starch excess protein 1) Length = 1399 Score = 30.0 bits (66), Expect = 6.8 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 292 SCNTAVHVQHVAQQSILLYWMINMGGGEELMPPRGLIKASHL 167 S T +HV ++ + L+W ++ GGE L PP ++ + L Sbjct: 377 SGKTKIHVATDFKEPVTLHWALSQKGGEWLDPPSDILPPNSL 418 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,078,565 Number of Sequences: 219361 Number of extensions: 1980500 Number of successful extensions: 3690 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3690 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)