| Clone Name | rbags13n03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NMT1_ARATH (Q9LTR9) Glycylpeptide N-tetradecanoyltransferase 1 (... | 32 | 2.3 | 2 | TOLB_ERWCT (Q6D7F2) Protein tolB precursor | 30 | 5.2 | 3 | CADC_ECOLI (P23890) Transcriptional activator cadC | 30 | 5.2 |
|---|
>NMT1_ARATH (Q9LTR9) Glycylpeptide N-tetradecanoyltransferase 1 (EC 2.3.1.97)| (Peptide N-myristoyltransferase 1) (Myristoyl-CoA:protein N-myristoyltransferase 1) (NMT 1) (Type I N-myristoyltransferase 1) Length = 434 Score = 31.6 bits (70), Expect = 2.3 Identities = 21/66 (31%), Positives = 32/66 (48%) Frame = -1 Query: 229 SDFEANPIVDGQWLLPCAVDIDSFLLKGALLVYFSKPNFCLVTNFLVYYCIPNPRRSEPL 50 +DF+ N + WLLP +DS+L++ P VT+F +Y +P+ P Sbjct: 300 TDFDENDVE--HWLLPREDVVDSYLVES--------PETHDVTDFCSFYTLPSTILGNPN 349 Query: 49 QTTLHA 32 TTL A Sbjct: 350 YTTLKA 355
>TOLB_ERWCT (Q6D7F2) Protein tolB precursor| Length = 430 Score = 30.4 bits (67), Expect = 5.2 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 88 TPKNWSLDRSLA*KNTQARHLSRGSYLYPLRMVTTTGHPRSGLLQNQTKI 237 TP W+ A Q + + GSYL ++V T+G+P + L QNQ K+ Sbjct: 87 TPAAWTALGIDAVVVGQVQPSADGSYLVSYQLVDTSGNPGNVLAQNQFKV 136
>CADC_ECOLI (P23890) Transcriptional activator cadC| Length = 512 Score = 30.4 bits (67), Expect = 5.2 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = -2 Query: 585 SSSAPVVSRIMQNQKGSCFWIWFLFLTSLGL 493 +++ P +++++ + FW+WF FL SLG+ Sbjct: 141 NTATPPEQSPVKSKRFTTFWVWFFFLLSLGI 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104,996,546 Number of Sequences: 219361 Number of extensions: 2259731 Number of successful extensions: 4866 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4866 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)