| Clone Name | rbags14b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BMPR2_MOUSE (O35607) Bone morphogenetic protein receptor type-2 ... | 29 | 2.4 | 2 | BMPR2_HUMAN (Q13873) Bone morphogenetic protein receptor type-2 ... | 29 | 2.4 | 3 | FRP1_SCHPO (Q04800) Ferric reductase transmembrane component (EC... | 28 | 4.2 |
|---|
>BMPR2_MOUSE (O35607) Bone morphogenetic protein receptor type-2 precursor (EC| 2.7.11.30) (Bone morphogenetic protein receptor type II) (BMP type II receptor) (BMPR-II) (BRK-3) Length = 1038 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 172 KRTDAWKTSSTXILQRKASNE*CFDQD-EATLTA 270 K +AWK +S + K + E C+DQD EA LTA Sbjct: 461 KFPEAWKENSLAVRSLKETIEDCWDQDAEARLTA 494
>BMPR2_HUMAN (Q13873) Bone morphogenetic protein receptor type-2 precursor (EC| 2.7.11.30) (Bone morphogenetic protein receptor type II) (BMP type II receptor) (BMPR-II) Length = 1038 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 172 KRTDAWKTSSTXILQRKASNE*CFDQD-EATLTA 270 K +AWK +S + K + E C+DQD EA LTA Sbjct: 461 KFPEAWKENSLAVRSLKETIEDCWDQDAEARLTA 494
>FRP1_SCHPO (Q04800) Ferric reductase transmembrane component (EC 1.16.1.7)| (Ferric-chelate reductase) Length = 564 Score = 28.5 bits (62), Expect = 4.2 Identities = 8/23 (34%), Positives = 18/23 (78%) Frame = -2 Query: 262 VWLHLDQSIIHLKLCVAVFXWTK 194 +WLH + ++++K+CVAV+ + + Sbjct: 236 IWLHHRRCVVYMKVCVAVYVFDR 258 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,883,507 Number of Sequences: 219361 Number of extensions: 546376 Number of successful extensions: 788 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 788 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)