| Clone Name | rbags13k08 |
|---|---|
| Clone Library Name | barley_pub |
>GAG_SIVV1 (P27972) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 520 Score = 37.7 bits (86), Expect = 0.034 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = -1 Query: 312 AKIVVE--RGTTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 AK++ E + QN+ Q GG + R P+C CG GH++ QC Sbjct: 369 AKVMAEMMQNLQSQNMVQQGGGRGRPRPPPKCYNCGKFGHMQRQC 413 Score = 26.2 bits (56), Expect(2) = 9.0 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESF 163 G ++Q EPR C KCG GH+ C RG +F Sbjct: 407 GHMQRQCPEPRKIKCLKCGKPGHLAKDC-RGQVNF 440 Score = 21.9 bits (45), Expect(2) = 9.0 Identities = 17/65 (26%), Positives = 25/65 (38%) Frame = -3 Query: 463 KEKIDMQQNINGKTVLKNSMIVESRKRDRGRPTNARCRPGYEVSQPRTKFCKNCRGKGHN 284 K +M QN+ + +++ RGRP +P K C NC GH Sbjct: 370 KVMAEMMQNLQSQNMVQQG-------GGRGRP------------RPPPK-CYNCGKFGHM 409 Query: 283 SAKCP 269 +CP Sbjct: 410 QRQCP 414
>GAG_SIVG1 (Q02843) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 513 Score = 36.6 bits (83), Expect = 0.077 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = -1 Query: 312 AKIVVERGTTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQCGRGWE-SFFR*RGVYHF 136 AK++VE + QN+ Q G K R +C CG GH++ +C + F+ + H Sbjct: 363 AKLMVEMMSNGQNMVQVGPQKKGPRGPLKCFNCGKFGHMQRECKAPRQIKCFKCGKIGHM 422 Query: 135 *KECRD 118 K+C++ Sbjct: 423 AKDCKN 428
>POL_HV2CA (P24107) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 28.5 bits (62), Expect(2) = 0.12 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESFFR 157 G + +Q + PR C KCG GHI T C F R Sbjct: 397 GHSARQCRAPRRQGCWKCGKPGHIMTNCPDRQAGFLR 433 Score = 26.2 bits (56), Expect(2) = 0.12 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -3 Query: 415 KNSMIVESRKRDRGRPTNARCRPGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 K ++ E+ K G P P Q RT C NC +GH++ +C A Sbjct: 360 KARLMAEALKEAMGPPPI----PFAAAQQRRTIKCWNCGKEGHSARQCRA 405
>GAG_SIVVT (P05892) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 519 Score = 35.8 bits (81), Expect = 0.13 Identities = 21/46 (45%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = -1 Query: 312 AKIVVERGTTPQN---VQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 AK++ E T QN VQQ G K+QR RC CG GH++ QC Sbjct: 369 AKVMAEMMQTMQNQNMVQQ--GGPKRQRPPLRCYNCGKFGHMQRQC 412
>GAG_FIVPE (P16087) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 35.8 bits (81), Expect = 0.13 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 2/58 (3%) Frame = -1 Query: 342 MK*VNQELSSAKIVVERGTTPQ--NVQQTGGANKKQRKEPRCDKCGLTGHIRTQCGRG 175 M+ + + L+ ++V +G+ P N ++ G ++ R+ +C+KCG GH+ +C +G Sbjct: 355 MQLLAEALTKVQVVQSKGSGPVCFNCKKPGHLARQCREVKKCNKCGKPGHLAAKCWQG 412
>GAG_HV2CA (P24106) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 27.7 bits (60), Expect(2) = 0.21 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQC 184 G + +Q + PR C KCG GHI T C Sbjct: 397 GHSARQCRAPRRQGCWKCGKPGHIMTNC 424 Score = 26.2 bits (56), Expect(2) = 0.21 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = -3 Query: 415 KNSMIVESRKRDRGRPTNARCRPGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 K ++ E+ K G P P Q RT C NC +GH++ +C A Sbjct: 360 KARLMAEALKEAMGPPPI----PFAAAQQRRTIKCWNCGKEGHSARQCRA 405
>GAG_FIVSD (P19027) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 35.0 bits (79), Expect = 0.22 Identities = 16/58 (27%), Positives = 33/58 (56%), Gaps = 2/58 (3%) Frame = -1 Query: 342 MK*VNQELSSAKIVVERGTTPQ--NVQQTGGANKKQRKEPRCDKCGLTGHIRTQCGRG 175 M+ + + L+ ++V +G+ P N ++ G ++ R +C+KCG GH+ +C +G Sbjct: 355 MQLLAEALTKVQVVQSKGSGPVCFNCKKPGHLARQCRDVKKCNKCGKPGHLAAKCWQG 412
>GAG_SIVVG (P27978) Gag polyprotein [Contains: Core protein p17; Core protein| p24; Core protein p15] Length = 521 Score = 34.7 bits (78), Expect = 0.29 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -1 Query: 312 AKIVVE--RGTTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 AK++ E + QN+ Q GG + R +C CG GH++ QC Sbjct: 373 AKVMAEMMQNMQSQNMMQQGGQRGRPRPPVKCYNCGKFGHMQRQC 417 Score = 26.2 bits (56), Expect(2) = 5.5 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESF 163 G ++Q EPR C KCG GH+ C RG +F Sbjct: 411 GHMQRQCPEPRKMRCLKCGKPGHLAKDC-RGQVNF 444 Score = 22.7 bits (47), Expect(2) = 5.5 Identities = 17/65 (26%), Positives = 25/65 (38%) Frame = -3 Query: 463 KEKIDMQQNINGKTVLKNSMIVESRKRDRGRPTNARCRPGYEVSQPRTKFCKNCRGKGHN 284 K +M QN+ + +++ RGRP +P K C NC GH Sbjct: 374 KVMAEMMQNMQSQNMMQQG-------GQRGRP------------RPPVK-CYNCGKFGHM 413 Query: 283 SAKCP 269 +CP Sbjct: 414 QRQCP 418
>POL_HV2ST (P20876) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1462 Score = 28.1 bits (61), Expect(2) = 0.32 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESFFR 157 G + +Q + PR C KCG GHI +C F R Sbjct: 397 GHSARQCRAPRRQGCWKCGKAGHIMAKCPERQAGFLR 433 Score = 25.0 bits (53), Expect(2) = 0.32 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 349 PGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 P Q RT C NC +GH++ +C A Sbjct: 378 PFAAAQQRRTIKCWNCGKEGHSARQCRA 405
>GAG_HV1A2 (P03349) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 501 Score = 34.3 bits (77), Expect = 0.38 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 288 TTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 T P N+ G + QRK +C CG GHI C Sbjct: 372 TNPANIMMQRGNFRNQRKTVKCFNCGKEGHIAKNC 406
>POL_HV1A2 (P03369) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1436 Score = 34.3 bits (77), Expect = 0.38 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 288 TTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 T P N+ G + QRK +C CG GHI C Sbjct: 372 TNPANIMMQRGNFRNQRKTVKCFNCGKEGHIAKNC 406
>GAG_FIVWO (Q05313) Gag polyprotein [Contains: Core protein p15; Major core| protein p24; Nucleic acid-binding protein p10] Length = 450 Score = 34.3 bits (77), Expect = 0.38 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 2/58 (3%) Frame = -1 Query: 342 MK*VNQELSSAKIVVERGTTPQ--NVQQTGGANKKQRKEPRCDKCGLTGHIRTQCGRG 175 M+ + + L+ ++V +G P N ++ G ++ R +C+KCG GH+ +C +G Sbjct: 355 MQLLAEALTKVQVVQSKGPGPVCFNCKRPGHLARQCRDVKKCNKCGKPGHLAAKCWQG 412
>DNAJ_CLOAB (P30725) Chaperone protein dnaJ| Length = 374 Score = 33.5 bits (75), Expect = 0.65 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 288 TTPQNVQQTGGANKKQRKEPR-CDKCGLTGHIRTQ 187 T +N + GG K+ P+ CDKCG TG IR Q Sbjct: 145 TRSENCETCGGTGAKKGTSPKTCDKCGGTGTIRVQ 179
>POL_HV2RO (P04584) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1463 Score = 28.5 bits (62), Expect(2) = 0.69 Identities = 15/37 (40%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESFFR 157 G + +Q + PR C KCG GHI T C F R Sbjct: 397 GHSARQCRAPRRQGCWKCGKPGHIMTNCPDRQAGFLR 433 Score = 23.5 bits (49), Expect(2) = 0.69 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 343 YEVSQPRTKF-CKNCRGKGHNSAKCPA 266 + +Q R F C NC +GH++ +C A Sbjct: 379 FAAAQQRKAFKCWNCGKEGHSARQCRA 405
>POL_HV2KR (Q74120) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1462 Score = 27.7 bits (60), Expect(2) = 0.69 Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESFFR 157 G + +Q + PR C KCG +GH+ C F R Sbjct: 397 GHSARQCRAPRRQGCWKCGKSGHVMANCPERQAGFLR 433 Score = 24.3 bits (51), Expect(2) = 0.69 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 349 PGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 P Q RT C NC GH++ +C A Sbjct: 378 PFAAAQQRRTIKCWNCGKDGHSARQCRA 405
>HEXP_LEIMA (Q04832) DNA-binding protein HEXBP (Hexamer-binding protein)| Length = 271 Score = 28.1 bits (61), Expect(2) = 1.7 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 3/27 (11%) Frame = -3 Query: 340 EVSQPRTKF---CKNCRGKGHNSAKCP 269 +V +PRT+ C+NC +GH + +CP Sbjct: 6 DVKRPRTESSTSCRNCGKEGHYARECP 32 Score = 27.7 bits (60), Expect(2) = 0.78 Identities = 17/55 (30%), Positives = 21/55 (38%) Frame = -3 Query: 394 SRKRDRGRPTNARCRPGYEVSQPRTKFCKNCRGKGHNSAKCPANGGGKQEAEEGT 230 S+ RG R R G + + C C GH S CP GG A + T Sbjct: 115 SQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT 169 Score = 25.8 bits (55), Expect(2) = 2.1 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 313 CKNCRGKGHNSAKCPANGGGKQ 248 C C +GH S CP++ GG + Sbjct: 99 CYKCGQEGHLSRDCPSSQGGSR 120 Score = 25.4 bits (54), Expect(2) = 2.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -3 Query: 346 GYEVSQPRTKFCKNCRGKGHNSAKCPANGGG 254 GY + RT C C GH S CP GG Sbjct: 161 GYSGAGDRT--CYKCGDAGHISRDCPNGQGG 189 Score = 25.0 bits (53), Expect(2) = 2.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 225 CDKCGLTGHIRTQCGRGWESFFR*RG 148 C KCG GHI +C S+ RG Sbjct: 224 CYKCGKPGHISRECPEAGGSYGGSRG 249 Score = 24.6 bits (52), Expect(2) = 2.1 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -1 Query: 258 GANKKQRKEPRCDKCGLTGHIRTQCGRG 175 GA + C KCG GHI C G Sbjct: 131 GAQGGYSGDRTCYKCGDAGHISRDCPNG 158 Score = 24.3 bits (51), Expect(2) = 0.78 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 6/41 (14%) Frame = -1 Query: 228 RCDKCGLTGHIRTQC------GRGWESFFR*RGVYHF*KEC 124 +C KCG +GH+ +C G G + ++ H +EC Sbjct: 197 KCYKCGESGHMSRECPSAGSTGSGDRACYKCGKPGHISREC 237 Score = 22.7 bits (47), Expect(2) = 1.7 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -1 Query: 252 NKKQRKEPRCDKCGLTGHIRTQC 184 +K + C +CG GH+ +C Sbjct: 36 SKGDERSTTCFRCGEEGHMSREC 58
>GAG_HV2ST (P20874) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 26.6 bits (57), Expect(2) = 0.95 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQC 184 G + +Q + PR C KCG GHI +C Sbjct: 397 GHSARQCRAPRRQGCWKCGKAGHIMAKC 424 Score = 25.0 bits (53), Expect(2) = 0.95 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 349 PGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 P Q RT C NC +GH++ +C A Sbjct: 378 PFAAAQQRRTIKCWNCGKEGHSARQCRA 405
>AIR2_YEAST (Q12476) Protein AIR2 (Arginine methyltransferase-interacting RING| finger protein 2) Length = 344 Score = 28.5 bits (62), Expect(2) = 0.99 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 237 KEPRCDKCGLTGHIRTQCGRGWE 169 K +C KC GH R+QC W+ Sbjct: 97 KAIQCSKCDEVGHYRSQCPHKWK 119 Score = 23.1 bits (48), Expect(2) = 0.99 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 313 CKNCRGKGHNSAKCP 269 C NC +GH CP Sbjct: 63 CNNCSQRGHLKKDCP 77
>GAG_HV2RO (P04590) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 521 Score = 27.7 bits (60), Expect(2) = 1.2 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQC 184 G + +Q + PR C KCG GHI T C Sbjct: 397 GHSARQCRAPRRQGCWKCGKPGHIMTNC 424 Score = 23.5 bits (49), Expect(2) = 1.2 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -3 Query: 343 YEVSQPRTKF-CKNCRGKGHNSAKCPA 266 + +Q R F C NC +GH++ +C A Sbjct: 379 FAAAQQRKAFKCWNCGKEGHSARQCRA 405
>GAG_HV1JR (P20873) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 503 Score = 32.3 bits (72), Expect = 1.4 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 288 TTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 T P + G + QRK +C CG GHI C Sbjct: 370 TNPATIMMQRGNFRNQRKNVKCFNCGKEGHIARNC 404
>POL_HV1JR (P20875) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1438 Score = 32.3 bits (72), Expect = 1.4 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 288 TTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 T P + G + QRK +C CG GHI C Sbjct: 370 TNPATIMMQRGNFRNQRKNVKCFNCGKEGHIARNC 404
>POL_HV2SB (P12451) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 27.3 bits (59), Expect(2) = 1.5 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 3/37 (8%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESFFR 157 G + +Q + PR C KCG +GHI C F R Sbjct: 396 GHSARQCRAPRRQGCWKCGKSGHIMANCPDRQAGFLR 432 Score = 23.5 bits (49), Expect(2) = 1.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 349 PGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 P Q R C NC +GH++ +C A Sbjct: 377 PFAAAQQKRAIKCWNCGKEGHSARQCRA 404
>POL_HV2D1 (P17757) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1461 Score = 27.7 bits (60), Expect(2) = 1.5 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQC 184 G + KQ + PR C KCG +GHI C Sbjct: 397 GHSAKQCRAPRRQGCWKCGKSGHIMANC 424 Score = 23.1 bits (48), Expect(2) = 1.5 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 349 PGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 P Q R C NC +GH++ +C A Sbjct: 378 PFAAAQQRRAIRCWNCGKEGHSAKQCRA 405
>GAG_HV2D1 (P17756) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 27.7 bits (60), Expect(2) = 1.6 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQC 184 G + KQ + PR C KCG +GHI C Sbjct: 397 GHSAKQCRAPRRQGCWKCGKSGHIMANC 424 Score = 23.1 bits (48), Expect(2) = 1.6 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 349 PGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 P Q R C NC +GH++ +C A Sbjct: 378 PFAAAQQRRAIRCWNCGKEGHSAKQCRA 405
>AIR1_YEAST (P40507) Protein AIR1 (Arginine methyltransferase-interacting RING| finger protein 1) Length = 360 Score = 27.3 bits (59), Expect(2) = 1.6 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 225 CDKCGLTGHIRTQCGRGWESFF 160 C C GH ++QC W+ F Sbjct: 114 CTNCNANGHYKSQCPHKWKKVF 135 Score = 23.5 bits (49), Expect(2) = 1.6 Identities = 7/15 (46%), Positives = 8/15 (53%) Frame = -3 Query: 313 CKNCRGKGHNSAKCP 269 C NC +GH CP Sbjct: 76 CNNCSQRGHLKRNCP 90
>UN13C_MOUSE (Q8K0T7) Unc-13 homolog C (Munc13-3) (Fragment)| Length = 1430 Score = 32.0 bits (71), Expect = 1.9 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = -3 Query: 595 DIVRMGDSNPEAFEFAMSKLSDAMVGLKEKANGSDGKCLEDIL-DKEKIDMQQNIN 431 D V + S E F++ + LSD + L K GKC D+ D E D+ Q+ N Sbjct: 660 DDVGLDSSTQEPFDYDTNSLSDQQLDLSSKDLDDLGKCHSDLQDDSESYDLTQDDN 715
>GAG_HV2KR (Q74119) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 520 Score = 26.2 bits (56), Expect(2) = 2.0 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQC 184 G + +Q + PR C KCG +GH+ C Sbjct: 397 GHSARQCRAPRRQGCWKCGKSGHVMANC 424 Score = 24.3 bits (51), Expect(2) = 2.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -3 Query: 349 PGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 P Q RT C NC GH++ +C A Sbjct: 378 PFAAAQQRRTIKCWNCGKDGHSARQCRA 405
>GAG_HV2SB (P12450) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 519 Score = 26.6 bits (57), Expect(2) = 2.6 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQC 184 G + +Q + PR C KCG +GHI C Sbjct: 396 GHSARQCRAPRRQGCWKCGKSGHIMANC 423 Score = 23.5 bits (49), Expect(2) = 2.6 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 349 PGYEVSQPRTKFCKNCRGKGHNSAKCPA 266 P Q R C NC +GH++ +C A Sbjct: 377 PFAAAQQKRAIKCWNCGKEGHSARQCRA 404
>GLH2_CAEEL (Q966L9) ATP-dependent RNA helicase glh-2 (EC 3.6.1.-) (Germline| helicase 2) Length = 974 Score = 31.2 bits (69), Expect = 3.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 313 CKNCRGKGHNSAKCP 269 C NC+G+GH SA+CP Sbjct: 455 CFNCKGEGHRSAECP 469
>GLH1_CAEEL (P34689) ATP-dependent RNA helicase glh-1 (EC 3.6.1.-) (Germline| helicase 1) Length = 763 Score = 31.2 bits (69), Expect = 3.2 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -3 Query: 313 CKNCRGKGHNSAKCP 269 C NC+G+GH SA+CP Sbjct: 244 CFNCKGEGHRSAECP 258
>CP3AS_BOVIN (P79102) Cytochrome P450 3A28 (EC 1.14.14.1) (CYPIIIA28)| Length = 507 Score = 30.8 bits (68), Expect = 4.2 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +3 Query: 162 RMIPIHGRIES*CVLSSRTYHTWVPSSASCLPPPFAGH-FAELCPFPRQF 308 RM PI GR+E C + +P + L P F H EL P P +F Sbjct: 365 RMFPIAGRLERVCKKDVEIHGVTIPKGTTVLVPLFVLHNNPELWPEPEEF 414
>GAG_HV1N5 (P12493) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 30.8 bits (68), Expect = 4.2 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 288 TTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 T P + G + QRK +C CG GHI C Sbjct: 370 TNPATIMIQKGNFRNQRKTVKCFNCGKEGHIAKNC 404
>POL_HV1N5 (P12497) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1434 Score = 30.8 bits (68), Expect = 4.2 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -1 Query: 288 TTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 T P + G + QRK +C CG GHI C Sbjct: 370 TNPATIMIQKGNFRNQRKTVKCFNCGKEGHIAKNC 404
>GAG_MMTVC (P11284) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 30.8 bits (68), Expect = 4.2 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 273 VQQT--GGANKKQRKEPRCDKCGLTGHIRTQC 184 V+QT GG + K P C CG TGHI+ C Sbjct: 508 VKQTYGGGKGGQGSKGPVCFSCGKTGHIKRDC 539
>GAG_SIVMS (P31634) Gag polyprotein [Contains: Core protein p17; Core protein| p24] Length = 510 Score = 25.4 bits (54), Expect(2) = 4.3 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQC 184 G KQ K PR C KCG GH +C Sbjct: 400 GHTAKQCKAPRRQGCWKCGKPGHQMAKC 427 Score = 23.9 bits (50), Expect(2) = 4.3 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 325 RTKFCKNCRGKGHNSAKCPA 266 RT C NC +GH + +C A Sbjct: 389 RTVKCWNCGKEGHTAKQCKA 408
>GAG_EIAVY (P69732) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 30.4 bits (67), Expect = 5.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 225 CDKCGLTGHIRTQCGRGWESFFR*RGVYHF*KECRDI 115 C CG GH+ +QC R + F+ + HF K+CR + Sbjct: 383 CYNCGKPGHLSSQC-RAPKVCFKCKQPGHFSKQCRSV 418
>GAG_EIAVC (P69731) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 30.4 bits (67), Expect = 5.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 225 CDKCGLTGHIRTQCGRGWESFFR*RGVYHF*KECRDI 115 C CG GH+ +QC R + F+ + HF K+CR + Sbjct: 383 CYNCGKPGHLSSQC-RAPKVCFKCKQPGHFSKQCRSV 418
>GAG_EIAV9 (P69730) Gag polyprotein [Contains: Matrix protein p15; Capsid| protein p26 (CA) (Major core protein p26); Nucleocapsid protein p11; p9] Length = 486 Score = 30.4 bits (67), Expect = 5.5 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 225 CDKCGLTGHIRTQCGRGWESFFR*RGVYHF*KECRDI 115 C CG GH+ +QC R + F+ + HF K+CR + Sbjct: 383 CYNCGKPGHLSSQC-RAPKVCFKCKQPGHFSKQCRSV 418
>TRFE_ONCKI (P79815) Serotransferrin precursor| Length = 687 Score = 30.4 bits (67), Expect = 5.5 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = -3 Query: 355 CRPGYEVSQPRTKFCKNCRGKGH----NSAKCPAN 263 C PG+EV P FC C+G G + +KC A+ Sbjct: 485 CAPGFEVDSP---FCAQCKGSGKSVGGDGSKCKAS 516
>POLX_TOBAC (P10978) Retrovirus-related Pol polyprotein from transposon TNT| 1-94 [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1328 Score = 30.4 bits (67), Expect = 5.5 Identities = 20/60 (33%), Positives = 25/60 (41%), Gaps = 5/60 (8%) Frame = -3 Query: 409 SMIVESRKRDRGRPTNARCRPGYEV-----SQPRTKFCKNCRGKGHNSAKCPANGGGKQE 245 ++I E R R R +N R G S+ R + C NC GH CP GK E Sbjct: 195 ALITEGRGRSYQRSSNNYGRSGARGKSKNRSKSRVRNCYNCNQPGHFKRDCPNPRKGKGE 254
>GAG_MMTVB (P10258) Gag polyprotein [Contains: Protein p10; Phosphorylated| protein pp21; Protein p3; Protein p8; Protein n; Major core protein p27; Nucleic acid-binding protein p14] Length = 590 Score = 30.4 bits (67), Expect = 5.5 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -1 Query: 273 VQQT--GGANKKQRKEPRCDKCGLTGHIRTQC 184 V+QT GG + + P C CG TGHIR C Sbjct: 508 VKQTYGGGKGGQGAEGPVCFSCGKTGHIRKDC 539
>POL_HV2D2 (P15833) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1464 Score = 30.4 bits (67), Expect = 5.5 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 3/39 (7%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESFFR*R 151 G +Q + PR C KCG TGHI ++C F R R Sbjct: 396 GHTARQCRAPRRQGCWKCGKTGHIMSKCPERQAGFLRVR 434
>CNBP_RAT (P62634) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 25.0 bits (53), Expect(2) = 6.1 Identities = 13/56 (23%), Positives = 23/56 (41%) Frame = -1 Query: 225 CDKCGLTGHIRTQCGRGWESFFR*RGVYHF*KECRDIISMS**CC*RLGVSNFLCK 58 C +CG +GH+ C ++ + H K+C++ CC G L + Sbjct: 54 CYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLAR 109 Score = 23.9 bits (50), Expect(2) = 6.1 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 313 CKNCRGKGHNSAKCPANGG 257 C C GH + +CP GG Sbjct: 6 CFKCGRSGHWARECPTGGG 24
>CNBP_PONPY (Q5R5R5) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 25.0 bits (53), Expect(2) = 6.1 Identities = 13/56 (23%), Positives = 23/56 (41%) Frame = -1 Query: 225 CDKCGLTGHIRTQCGRGWESFFR*RGVYHF*KECRDIISMS**CC*RLGVSNFLCK 58 C +CG +GH+ C ++ + H K+C++ CC G L + Sbjct: 54 CYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLAR 109 Score = 23.9 bits (50), Expect(2) = 6.1 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 313 CKNCRGKGHNSAKCPANGG 257 C C GH + +CP GG Sbjct: 6 CFKCGRSGHWARECPTGGG 24
>CNBP_HUMAN (P62633) Cellular nucleic acid-binding protein (CNBP) (Zinc finger| protein 9) Length = 177 Score = 25.0 bits (53), Expect(2) = 6.1 Identities = 13/56 (23%), Positives = 23/56 (41%) Frame = -1 Query: 225 CDKCGLTGHIRTQCGRGWESFFR*RGVYHF*KECRDIISMS**CC*RLGVSNFLCK 58 C +CG +GH+ C ++ + H K+C++ CC G L + Sbjct: 54 CYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLAR 109 Score = 23.9 bits (50), Expect(2) = 6.1 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 313 CKNCRGKGHNSAKCPANGG 257 C C GH + +CP GG Sbjct: 6 CFKCGRSGHWARECPTGGG 24
>BIK1_YEAST (P11709) Nuclear fusion protein BIK1| Length = 440 Score = 30.0 bits (66), Expect = 7.2 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 325 RTKFCKNCRGKGHNSAKCPANGGGKQE 245 R ++C++C GHN+A+CP + Q+ Sbjct: 412 RQQWCEHCDTMGHNTAECPHHNPDNQQ 438
>GAG_HV1Y2 (P35962) Gag polyprotein (Pr55Gag) [Contains: Matrix protein p17| (MA); Capsid protein p24 (CA); Spacer peptide p2; Nucleocapsid protein p7 (NC); Spacer peptide p1; p6] Length = 499 Score = 30.0 bits (66), Expect = 7.2 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -1 Query: 333 VNQELSSAKIVVERGTTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 ++Q +SA I+++RG + QRK +C CG GHI C Sbjct: 366 MSQVTNSATIMMQRGNF-----------RNQRKTVKCFNCGKEGHIAKNC 404
>POL_HV1Y2 (P35963) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.16) (Retropepsin) (PR); Reverse trans Length = 1434 Score = 30.0 bits (66), Expect = 7.2 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -1 Query: 333 VNQELSSAKIVVERGTTPQNVQQTGGANKKQRKEPRCDKCGLTGHIRTQC 184 ++Q +SA I+++RG + QRK +C CG GHI C Sbjct: 366 MSQVTNSATIMMQRGNF-----------RNQRKTVKCFNCGKEGHIAKNC 404
>NET1_HUMAN (O95631) Netrin-1 precursor| Length = 604 Score = 29.6 bits (65), Expect = 9.4 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 4/55 (7%) Frame = -3 Query: 580 GDSNPEAFEFAMSK----LSDAMVGLKEKANGSDGKCLEDILDKEKIDMQQNING 428 GD N + E A +SD VG + K NG +C+ D D D + N G Sbjct: 258 GDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRTDSLVCDCRHNTAG 312
>MTH3_DROME (Q9V818) Probable G-protein coupled receptor Mth-like 3 precursor| (Protein methuselah-like 3) Length = 511 Score = 29.6 bits (65), Expect = 9.4 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 7/66 (10%) Frame = +3 Query: 120 LCILFKNDTHLVIERMIPIHGRIES*CVLSSR-------TYHTWVPSSASCLPPPFAGHF 278 +CI+ +L +E++ +HG+ C L+S + W SS C+ F G+F Sbjct: 224 ICIILTISVYLYVEKLRNLHGKCFI-CYLASLFLGYFFLVLNVWKYSSGFCVTAGFLGYF 282 Query: 279 AELCPF 296 + + F Sbjct: 283 SVIAAF 288
>RAG1_HUMAN (P15918) V(D)J recombination-activating protein 1 (RAG-1) (RING| finger protein 74) Length = 1043 Score = 29.6 bits (65), Expect = 9.4 Identities = 24/93 (25%), Positives = 41/93 (44%), Gaps = 5/93 (5%) Frame = +2 Query: 191 VLMCPVKPHLSHLGSFLCFLFAPPVCWTFCGVVP---LSTTIFAELSSWLTYFISRSTSC 361 +L PV+ + H+ +C L V ++C T + + + S+L+ S C Sbjct: 299 ILADPVETNCKHVFCRVCILRCLKVMGSYCPSCRYPCFPTDLESPVKSFLSVLNSLMVKC 358 Query: 362 IRRSAT--ISLARLYYHGIFQHSFSVDILLHIN 454 + +SL + Y H I H S +I +HIN Sbjct: 359 PAKECNEEVSLEK-YNHHISSHKESKEIFVHIN 390
>BAZ2B_CHICK (Q9DE13) Bromodomain adjacent to zinc finger domain 2B (Extracellular| matrix protein F22) Length = 2130 Score = 29.6 bits (65), Expect = 9.4 Identities = 28/123 (22%), Positives = 52/123 (42%), Gaps = 14/123 (11%) Frame = -3 Query: 682 EST*KIYKGRNPILGSTTFRHTT--------------LYTTALDIVRMGDSNPEAFEFAM 545 ES + KGR P +GST F +T + ++R +A Sbjct: 773 ESRMRRRKGRPPNVGSTEFLDSTDAKLLRKLQAQEIARQAAQIKLLRKLQKQEQARAAKE 832 Query: 544 SKLSDAMVGLKEKANGSDGKCLEDILDKEKIDMQQNINGKTVLKNSMIVESRKRDRGRPT 365 +K A++ +EK + ++ + +EKI Q I + L+ I+E++K+ + Sbjct: 833 AKKQQAIMAAEEKRKQKEQ--IKIMKQQEKIKRIQQIRMEKELRAQQILEAKKKKKEEAA 890 Query: 364 NAR 356 NA+ Sbjct: 891 NAK 893
>PAR1_XENLA (P47749) Proteinase-activated receptor 1 precursor (PAR-1)| (Thrombin receptor) Length = 420 Score = 29.6 bits (65), Expect = 9.4 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 7/63 (11%) Frame = +1 Query: 454 FFLCLGCPPNICRLTHLLSLLNQPLHQIILTLQTQKPLGCC-------HPFAQCLVLLYK 612 F +C G P N+ LTH L N+ L+ + + CC + +QC LY Sbjct: 321 FIICFG-PTNVLFLTHYLQEANEFLYFAYILSACVGSVSCCLDPLIYYYASSQCQRYLYS 379 Query: 613 ELC 621 LC Sbjct: 380 LLC 382
>MTH4_DROME (Q9V817) Probable G-protein coupled receptor Mth-like 4 precursor| (Protein methuselah-like 4) Length = 480 Score = 29.6 bits (65), Expect = 9.4 Identities = 17/66 (25%), Positives = 31/66 (46%), Gaps = 7/66 (10%) Frame = +3 Query: 120 LCILFKNDTHLVIERMIPIHGRIES*CVLSSR-------TYHTWVPSSASCLPPPFAGHF 278 +CI+ +L +E++ +HG+ C L+S + W SS C+ F G+F Sbjct: 221 ICIILTISVYLYVEKLRNLHGKCFI-CYLASLFLGYFFLVLNVWKYSSGFCVTAGFLGYF 279 Query: 279 AELCPF 296 + + F Sbjct: 280 SVMAAF 285
>POL_HV2G1 (P18042) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1463 Score = 29.6 bits (65), Expect = 9.4 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -1 Query: 258 GANKKQRKEPR---CDKCGLTGHIRTQCGRGWESFFR 157 G + +Q + PR C KCG TGH+ +C F R Sbjct: 398 GHSARQCRAPRRQGCWKCGKTGHVMAKCPERQAGFLR 434 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 108,902,989 Number of Sequences: 219361 Number of extensions: 2425115 Number of successful extensions: 7184 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 6588 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7151 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)