| Clone Name | rbags13k06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | THII_ARCFU (O29382) Probable thiamine biosynthesis protein thiI | 33 | 0.57 | 2 | CN054_HUMAN (Q8N9W8) Protein C14orf54 | 32 | 1.7 | 3 | SYM_BACTN (Q8A3M1) Methionyl-tRNA synthetase (EC 6.1.1.10) (Meth... | 30 | 6.3 |
|---|
>THII_ARCFU (O29382) Probable thiamine biosynthesis protein thiI| Length = 374 Score = 33.1 bits (74), Expect = 0.57 Identities = 21/57 (36%), Positives = 33/57 (57%) Frame = -3 Query: 275 LIAAKEGKKLVITADEGSRVALAELDDNAEY*SALEFTGIIKHLLGLNEGEMALVVK 105 LIA KEG K V+T D S+VA LD+ SA + ++ L+G+++ E+ + K Sbjct: 262 LIAEKEGCKAVVTGDSLSQVASQTLDNINVIYSASKL-AVLPPLIGMDKEEIVAIAK 317
>CN054_HUMAN (Q8N9W8) Protein C14orf54| Length = 422 Score = 31.6 bits (70), Expect = 1.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 336 AKCRPHQHEPKEAQECFEGGSY 271 A C PH H+P++ Q +GG Y Sbjct: 17 ALCTPHSHDPRDLQNMLDGGEY 38
>SYM_BACTN (Q8A3M1) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 679 Score = 29.6 bits (65), Expect = 6.3 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = -3 Query: 389 TIVETLDKVAITEEKCPKQNAALTNMSLRKLKSALKEGLIAAKE 258 TIV + K EE KQ + N++ RKLK + EG+I + E Sbjct: 614 TIVSGIAKHYQPEELVGKQVCFIANLAPRKLKGIVSEGMILSAE 657 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,658,750 Number of Sequences: 219361 Number of extensions: 1102620 Number of successful extensions: 3179 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3178 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)