| Clone Name | rbags13g08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DYXC1_MOUSE (Q8R368) Dyslexia susceptibility 1 candidate gene 1 ... | 34 | 0.34 | 2 | MSH6_ARATH (O04716) DNA mismatch repair protein MSH6-1 (AtMsh6-1) | 31 | 2.9 | 3 | RS17_RALEJ (Q46WF3) 30S ribosomal protein S17 | 30 | 6.4 | 4 | V245_FOWPV (Q9J4Z5) Putative ankyrin repeat protein FPV245 | 30 | 6.4 |
|---|
>DYXC1_MOUSE (Q8R368) Dyslexia susceptibility 1 candidate gene 1 protein homolog| Length = 420 Score = 34.3 bits (77), Expect = 0.34 Identities = 23/85 (27%), Positives = 43/85 (50%) Frame = -3 Query: 618 PGIPASVLQRANEKSIDFEANYGKRRCATKDKAICTQEDNFATIKDLFRIVKAGNHKEDE 439 PG+ ++QR EKSI +A K + AT+ KA+ +ED + ++ +I +E+E Sbjct: 89 PGVDKEMMQRIREKSI-LQAQ-EKAKEATEAKAVAKREDQRYALGEMMKI------EEEE 140 Query: 438 AASLSRIREVQMRARVQAMEA*SSC 364 + ++E + + +EA C Sbjct: 141 RKKIEDMKENERKKATSELEAWKEC 165
>MSH6_ARATH (O04716) DNA mismatch repair protein MSH6-1 (AtMsh6-1)| Length = 1324 Score = 31.2 bits (69), Expect = 2.9 Identities = 17/31 (54%), Positives = 19/31 (61%) Frame = -3 Query: 615 GIPASVLQRANEKSIDFEANYGKRRCATKDK 523 G+P VLQRA KS +FEA YGK T K Sbjct: 1254 GLPDYVLQRAVIKSQEFEALYGKNHRKTDHK 1284
>RS17_RALEJ (Q46WF3) 30S ribosomal protein S17| Length = 92 Score = 30.0 bits (66), Expect = 6.4 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 230 IRSRSKNFHERTRQYRISKMMPIQKGHQAGKRKNWGKSPLIK 355 +RS+ + H+ QY+ + IQ+G + K+W S L++ Sbjct: 46 LRSKKYHAHDEANQYKEGDKVEIQEGRPLSRTKSWVVSRLVE 87
>V245_FOWPV (Q9J4Z5) Putative ankyrin repeat protein FPV245| Length = 436 Score = 30.0 bits (66), Expect = 6.4 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +2 Query: 260 RTRQYRISKMMPIQKGHQAGKRKNWGKSPLIKWVMQLDYASIACTL 397 R+ Y I K++ ++KG A + N+G SPL DYA I L Sbjct: 166 RSNSYEIIKLL-LEKGAYANVKDNYGNSPLHNAAKYGDYACIKLVL 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,841,231 Number of Sequences: 219361 Number of extensions: 1951067 Number of successful extensions: 4426 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4424 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)