| Clone Name | rbags12k16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | STUB_DROME (Q05319) Serine proteinase stubble (EC 3.4.21.-) (Pro... | 31 | 1.9 | 2 | SAR1_TOBAC (P52885) GTP-binding protein SAR1 | 30 | 5.6 | 3 | TRMU_NEIMA (Q9JTJ9) Probable tRNA (5-methylaminomethyl-2-thiouri... | 29 | 9.6 |
|---|
>STUB_DROME (Q05319) Serine proteinase stubble (EC 3.4.21.-) (Protein| stubble-stubbloid) [Contains: Serine proteinase stubble non-catalytic chain; Serine proteinase stubble catalytic chain] Length = 787 Score = 31.2 bits (69), Expect = 1.9 Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 7/76 (9%) Frame = +2 Query: 281 PCPAGWVG*GRVG-------SDQGTTSQVALICSRTGASEMSCSSSK*VKGYNTSVI*RW 439 P P GW G V S ++ ++ RT S S +TS+I W Sbjct: 314 PRPTGWTKPGIVNLPMPARPSKPSKPTKKPIVYDRTPPPPPSVPPSTSTSTTSTSLI--W 371 Query: 440 PGQCHQPLPYEPLPPR 487 P Q H P P+ P P+ Sbjct: 372 PAQTHPPQPHRPTRPQ 387
>SAR1_TOBAC (P52885) GTP-binding protein SAR1| Length = 198 Score = 29.6 bits (65), Expect = 5.6 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 202 LCCVRRKSWR*MMSNQPAAPLKRARV 125 +CC+R+ +WR M A+PL R +V Sbjct: 138 ICCLRKMNWRYHMGANGASPLARGKV 163
>TRMU_NEIMA (Q9JTJ9) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 367 Score = 28.9 bits (63), Expect = 9.6 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 270 PCRLVYLDDDRVGLLFIGPQY 208 PC L YLDD+ V L+F PQ+ Sbjct: 314 PCELRYLDDETVELVFDEPQW 334 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,876,118 Number of Sequences: 219361 Number of extensions: 1063233 Number of successful extensions: 2785 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2785 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)