| Clone Name | rbags12h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPAG6_HUMAN (O75602) Sperm-associated antigen 6 (PF16 protein ho... | 31 | 3.0 | 2 | BIOA_MYCLE (P45488) Adenosylmethionine-8-amino-7-oxononanoate am... | 29 | 8.7 |
|---|
>SPAG6_HUMAN (O75602) Sperm-associated antigen 6 (PF16 protein homolog) (Sperm| flagellar protein) (Repro-SA-1) Length = 509 Score = 30.8 bits (68), Expect = 3.0 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -1 Query: 514 LPQQPSYVKSAASTVVKRPLAQHTPELTAMV 422 L + YVK AST++ R +A+HTPEL+ +V Sbjct: 260 LKDKDEYVKKNASTLI-REIAKHTPELSQLV 289
>BIOA_MYCLE (P45488) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase| (EC 2.6.1.62) (7,8-diamino-pelargonic acid aminotransferase) (DAPA aminotransferase) Length = 436 Score = 29.3 bits (64), Expect = 8.7 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = -1 Query: 511 PQQPSYVKSAASTVVKRPLAQHTPELTAMV 422 PQ P A S + LAQHTPEL A+V Sbjct: 191 PQVPRDYDPAYSKAFETQLAQHTPELAAVV 220 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,602,924 Number of Sequences: 219361 Number of extensions: 1162962 Number of successful extensions: 2959 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2957 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5044307840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)