ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags11p08 |
|---|---|
| Clone Library Name | barley_pub |
>ATPG3_IPOBA (P26360) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 326 Score = 43.5 bits (101), Expect = 2e-04 Identities = 22/24 (91%), Positives = 23/24 (95%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALEG 54 +RTRQASITTEL EIISGASALEG Sbjct: 303 NRTRQASITTELIEIISGASALEG 326
>ATPG3_ARATH (Q96250) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 325 Score = 41.2 bits (95), Expect = 8e-04 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +RTRQASITTEL EIISGASALE Sbjct: 300 NRTRQASITTELIEIISGASALE 322
>ATPG_LACAC (Q9RGY2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 320 Score = 38.1 bits (87), Expect = 0.007 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA ITTE+TEIISGA+ALE Sbjct: 298 NRARQAQITTEITEIISGANALE 320
>ATPG_LACJO (Q74K16) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 318 Score = 36.6 bits (83), Expect = 0.019 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA ITTE+TEII GA+ALE Sbjct: 296 NRARQAQITTEITEIIGGANALE 318
>ATPG_STRR6 (Q7CRB2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 35.8 bits (81), Expect = 0.033 Identities = 16/23 (69%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GASALE Sbjct: 270 NRARQAAITQEITEIVAGASALE 292
>ATPG_STRPN (Q97PT5) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 35.8 bits (81), Expect = 0.033 Identities = 16/23 (69%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GASALE Sbjct: 270 NRARQAAITQEITEIVAGASALE 292
>ATPG_STRSA (Q9ZJ02) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 293 Score = 35.8 bits (81), Expect = 0.033 Identities = 16/23 (69%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GASALE Sbjct: 271 NRARQAAITQEITEIVAGASALE 293
>ATPG_STRTR (Q8RKV3) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 35.4 bits (80), Expect = 0.043 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GASALE Sbjct: 270 NRARQAAITQEITEIVGGASALE 292
>ATPG_STRT2 (Q5M5J2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 35.4 bits (80), Expect = 0.043 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GASALE Sbjct: 270 NRARQAAITQEITEIVGGASALE 292
>ATPG_STRT1 (Q5M105) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 35.4 bits (80), Expect = 0.043 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GASALE Sbjct: 270 NRARQAAITQEITEIVGGASALE 292
>ATPG_BACLD (Q65DX3) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 284 Score = 35.4 bits (80), Expect = 0.043 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQASIT E+TEI+ GA+ALE Sbjct: 262 NRARQASITQEITEIVGGAAALE 284
>ATPG_GEOSL (Q74GY1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 35.4 bits (80), Expect = 0.043 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALEG 54 +R RQA+ITTEL EIISGA +++G Sbjct: 264 NRARQAAITTELMEIISGAESIKG 287
>ATPG_LACLC (Q9RAU1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 35.0 bits (79), Expect = 0.057 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQASIT E+TEI++GASAL Sbjct: 268 NRARQASITQEITEIVAGASAL 289
>ATPG_LACLA (Q9CER9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 35.0 bits (79), Expect = 0.057 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQASIT E+TEI++GASAL Sbjct: 268 NRARQASITQEITEIVAGASAL 289
>ATPG_ZYMMO (Q5NQZ0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 298 Score = 34.7 bits (78), Expect = 0.074 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA+ITTEL EIISGA AL Sbjct: 277 NRLRQAAITTELVEIISGAEAL 298
>ATPG_STRPM (Q48UD4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 34.7 bits (78), Expect = 0.074 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+ALE Sbjct: 269 NRARQAAITQEITEIVAGANALE 291
>ATPG_STRP8 (Q7CND4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 34.7 bits (78), Expect = 0.074 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+ALE Sbjct: 269 NRARQAAITQEITEIVAGANALE 291
>ATPG_STRP6 (Q5XCY1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 34.7 bits (78), Expect = 0.074 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+ALE Sbjct: 269 NRARQAAITQEITEIVAGANALE 291
>ATPG_STRP3 (Q8K827) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 34.7 bits (78), Expect = 0.074 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+ALE Sbjct: 269 NRARQAAITQEITEIVAGANALE 291
>ATPG_STRP1 (Q9A0I8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 34.7 bits (78), Expect = 0.074 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+ALE Sbjct: 269 NRARQAAITQEITEIVAGANALE 291
>ATPG_STRBO (O50158) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 34.7 bits (78), Expect = 0.074 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+ALE Sbjct: 269 NRARQAAITQEITEIVAGANALE 291
>ATPG_MESFL (Q6F203) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 281 Score = 34.7 bits (78), Expect = 0.074 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALEG 54 +R RQASIT E++EI+SGA+AL G Sbjct: 258 NRERQASITQEISEIVSGANALMG 281
>ATPG_STRA5 (Q8E073) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 293 Score = 34.7 bits (78), Expect = 0.074 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+ALE Sbjct: 271 NRARQAAITQEITEIVAGANALE 293
>ATPG_STRA3 (Q8E5U9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 293 Score = 34.7 bits (78), Expect = 0.074 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+ALE Sbjct: 271 NRARQAAITQEITEIVAGANALE 293
>ATPG_PHOLL (Q7NA93) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 34.7 bits (78), Expect = 0.074 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGASA+ Sbjct: 266 NKARQASITQELTEIVSGASAV 287
>ATPG_MOUSE (Q91VR2) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 298 Score = 34.3 bits (77), Expect = 0.096 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +RTRQA IT EL EIISGA+AL+ Sbjct: 276 NRTRQAVITKELIEIISGAAALD 298
>ATPG_MACFA (Q4R5B0) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 298 Score = 34.3 bits (77), Expect = 0.096 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +RTRQA IT EL EIISGA+AL+ Sbjct: 276 NRTRQAVITKELIEIISGAAALD 298
>ATPG_HUMAN (P36542) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 298 Score = 34.3 bits (77), Expect = 0.096 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +RTRQA IT EL EIISGA+AL+ Sbjct: 276 NRTRQAVITKELIEIISGAAALD 298
>ATPG_BOVIN (P05631) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 298 Score = 34.3 bits (77), Expect = 0.096 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +RTRQA IT EL EIISGA+AL+ Sbjct: 276 NRTRQAVITKELIEIISGAAALD 298
>ATPG_BACME (P20602) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 285 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 263 NRARQAAITQEITEIVGGAAALE 285
>ATPG_BACHD (Q9K6H4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 285 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 263 NRARQAAITQEITEIVGGAAALE 285
>ATPG_LISMO (Q927W3) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 268 NRARQAAITQEITEIVGGAAALE 290
>ATPG_LISMF (Q71WP8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 268 NRARQAAITQEITEIVGGAAALE 290
>ATPG_LISIN (Q7ANV0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 268 NRARQAAITQEITEIVGGAAALE 290
>ATPG_BACSU (P37810) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 268 NRARQAAITQEITEIVGGAAALE 290
>ATPG_BACSK (Q5WB77) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 266 NRARQAAITQEITEIVGGAAALE 288
>ATPG_PHATR (Q41075) ATP synthase gamma chain, chloroplast precursor (EC| 3.6.3.14) Length = 370 Score = 34.3 bits (77), Expect = 0.096 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA++T EL EIISGASAL+ Sbjct: 348 NRARQAAVTQELLEIISGASALD 370
>ATPG_ODOSI (Q06908) ATP synthase gamma chain, chloroplast precursor (EC| 3.6.3.14) Length = 370 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA++T E+ EI+SGASALE Sbjct: 348 NRARQAAVTQEILEIVSGASALE 370
>ATPG_BACPF (P22482) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 267 NRARQAAITQEITEIVGGAAALE 289
>ATPG_BACHK (Q6HAX9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 264 NRARQAAITQEITEIVGGAAALE 286
>ATPG_BACCZ (Q630U2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 264 NRARQAAITQEITEIVGGAAALE 286
>ATPG_BACCR (Q814W1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 264 NRARQAAITQEITEIVGGAAALE 286
>ATPG_BACC1 (Q72XE7) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 264 NRARQAAITQEITEIVGGAAALE 286
>ATPG_BACAN (Q81JZ4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ GA+ALE Sbjct: 264 NRARQAAITQEITEIVGGAAALE 286
>ATPG_RAT (P35435) ATP synthase gamma chain, mitochondrial (EC 3.6.3.14)| Length = 273 Score = 34.3 bits (77), Expect = 0.096 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +RTRQA IT EL EIISGA+AL+ Sbjct: 251 NRTRQAVITKELIEIISGAAALD 273
>ATPG_ENTHR (P43452) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 300 Score = 34.3 bits (77), Expect = 0.096 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQ +IT E+TEI++GASALE Sbjct: 278 NRARQGAITQEITEIVAGASALE 300
>ATPG_SYMTH (Q67TB8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 33.9 bits (76), Expect = 0.13 Identities = 14/24 (58%), Positives = 21/24 (87%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALEG 54 +R RQA+IT E++EI+ GA+AL+G Sbjct: 265 NRARQAAITREISEIVGGANALQG 288
>ATPG_GEOKA (Q5KUJ2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 285 Score = 33.5 bits (75), Expect = 0.16 Identities = 14/23 (60%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+AL+ Sbjct: 263 NRARQAAITQEITEIVAGANALQ 285
>ATPG_BUCBP (Q89B40) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 33.5 bits (75), Expect = 0.16 Identities = 17/30 (56%), Positives = 23/30 (76%) Frame = -2 Query: 149 LTVLH*HTDRTRQASITTELTEIISGASAL 60 L L + ++ RQ+SIT ELTEIISGA+A+ Sbjct: 259 LKALQMNYNKVRQSSITQELTEIISGAAAV 288
>ATPG_STRMU (P95788) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 33.5 bits (75), Expect = 0.16 Identities = 14/23 (60%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+AL+ Sbjct: 270 NRVRQAAITQEITEIVAGANALD 292
>ATPG_PONPY (Q5RBS9) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 297 Score = 33.5 bits (75), Expect = 0.16 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +RTRQA IT EL EIISGA+AL Sbjct: 276 NRTRQAVITKELIEIISGAAAL 297
>ATPG_DROME (O01666) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 297 Score = 33.5 bits (75), Expect = 0.16 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +RTRQA IT EL EIISGA+AL Sbjct: 275 NRTRQAVITRELIEIISGAAAL 296
>ATPG_BACP3 (P09222) ATP synthase gamma chain precursor (EC 3.6.3.14) (ATP| synthase F1 sector gamma subunit) Length = 286 Score = 33.5 bits (75), Expect = 0.16 Identities = 14/23 (60%), Positives = 21/23 (91%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++GA+AL+ Sbjct: 264 NRARQAAITQEITEIVAGANALQ 286
>ATPG_SHIFL (P0ABA9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGA+A+ Sbjct: 266 NKARQASITQELTEIVSGAAAV 287
>ATPG_SALTY (Q8ZKW8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGA+A+ Sbjct: 266 NKARQASITQELTEIVSGAAAV 287
>ATPG_SALTI (Q8Z2Q5) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGA+A+ Sbjct: 266 NKARQASITQELTEIVSGAAAV 287
>ATPG_SALPA (Q5PKX1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGA+A+ Sbjct: 266 NKARQASITQELTEIVSGAAAV 287
>ATPG_SALCH (Q57HX8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGA+A+ Sbjct: 266 NKARQASITQELTEIVSGAAAV 287
>ATPG_ECOLI (P0ABA6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGA+A+ Sbjct: 266 NKARQASITQELTEIVSGAAAV 287
>ATPG_ECOL6 (P0ABA7) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGA+A+ Sbjct: 266 NKARQASITQELTEIVSGAAAV 287
>ATPG_ECO57 (P0ABA8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.5 bits (75), Expect = 0.16 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+SGA+A+ Sbjct: 266 NKARQASITQELTEIVSGAAAV 287
>ATPG_PROMO (P29710) ATP synthase gamma chain, sodium ion specific (EC| 3.6.3.15) Length = 281 Score = 33.1 bits (74), Expect = 0.21 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA+IT E++EI+SGASAL Sbjct: 260 NRERQAAITQEISEIVSGASAL 281
>ATPG_ENTFA (Q831A4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 302 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQ +IT E+TEI++GA+ALE Sbjct: 280 NRARQGAITQEITEIVAGAAALE 302
>ATPG_STAES (Q8CNJ6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT ++TEI+ G+SALE Sbjct: 266 NRARQAAITQQITEIVGGSSALE 288
>ATPG_STAEQ (Q5HMB8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 33.1 bits (74), Expect = 0.21 Identities = 14/23 (60%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT ++TEI+ G+SALE Sbjct: 266 NRARQAAITQQITEIVGGSSALE 288
>ATPG_CHLTE (Q8KAW9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 33.1 bits (74), Expect = 0.21 Identities = 16/31 (51%), Positives = 24/31 (77%) Frame = -2 Query: 149 LTVLH*HTDRTRQASITTELTEIISGASALE 57 + VL+ +R RQA+IT EL+EI++GA AL+ Sbjct: 261 IRVLNISYNRARQAAITKELSEIVAGADALK 291
>ATPG_BDEBA (Q6MGM6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 295 Score = 33.1 bits (74), Expect = 0.21 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALEG 54 ++ RQ ITTEL EI+SGA AL+G Sbjct: 272 NKLRQEKITTELIEIVSGAEALKG 295
>ATPG_RHORU (P07227) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 299 Score = 33.1 bits (74), Expect = 0.21 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +RTRQA IT EL EIISGA A+ Sbjct: 278 NRTRQAQITKELIEIISGAEAI 299
>ATPG_YERPS (Q663Q7) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.1 bits (74), Expect = 0.21 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+ GASA+ Sbjct: 266 NKARQASITQELTEIVGGASAV 287
>ATPG_YERPE (Q8Z9S5) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.1 bits (74), Expect = 0.21 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+ GASA+ Sbjct: 266 NKARQASITQELTEIVGGASAV 287
>ATPG_ERWCT (Q6CYJ4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 33.1 bits (74), Expect = 0.21 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT ELTEI+ GASA+ Sbjct: 266 NKARQASITQELTEIVGGASAV 287
>ATPG_RHOCA (P72246) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQA+IT EL EIISGA AL Sbjct: 269 NRSRQAAITKELIEIISGAEAL 290
>ATPG_BUCDN (Q9RQ80) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 32.7 bits (73), Expect = 0.28 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT ELTEII+GASA+ Sbjct: 266 NKVRQATITQELTEIIAGASAV 287
>ATPG_BRAJA (Q89X73) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +RTRQA IT EL EIISGA A+ Sbjct: 269 NRTRQAQITKELIEIISGAEAV 290
>ATPG_RHOPA (Q6NDD1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +RTRQA IT EL EIISGA A+ Sbjct: 270 NRTRQAMITKELIEIISGAEAI 291
>ATPG_RALEJ (Q46VX9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 32.7 bits (73), Expect = 0.28 Identities = 14/22 (63%), Positives = 21/22 (95%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++TRQA+IT EL+EI+SGA+A+ Sbjct: 270 NKTRQAAITKELSEIVSGAAAV 291
>ATPG_DESVH (Q72E03) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 32.7 bits (73), Expect = 0.28 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALEG 54 ++TRQASIT +L +I+ GA AL+G Sbjct: 268 NKTRQASITRDLMDIVGGAEALKG 291
>ATPG_BARQU (Q6FYM2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 303 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA ITTEL EII+GA AL Sbjct: 282 NRQRQAQITTELIEIIAGAEAL 303
>ATPG_BARHE (Q6G1W8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 303 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA ITTEL EII+GA AL Sbjct: 282 NRQRQAQITTELIEIIAGAEAL 303
>ATPG_RHOBL (P05436) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 32.7 bits (73), Expect = 0.28 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQA+IT EL EIISGA AL Sbjct: 265 NRSRQAAITKELIEIISGAEAL 286
>ATPG_OCEIH (Q8EM82) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 32.7 bits (73), Expect = 0.28 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI+ G +ALE Sbjct: 264 NRARQAAITQEITEIVGGVAALE 286
>ATPG_KLULA (P49377) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 289 Score = 32.7 bits (73), Expect = 0.28 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +RTRQA IT EL +II+GAS+L+ Sbjct: 267 NRTRQAVITNELVDIITGASSLD 289
>ATPG_AZOSE (Q5P4E3) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 32.7 bits (73), Expect = 0.28 Identities = 14/22 (63%), Positives = 21/22 (95%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++TRQA+IT EL+EI+SGA+A+ Sbjct: 268 NKTRQAAITKELSEIVSGAAAV 289
>ATPG_NEIMB (Q9JXQ1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 32.3 bits (72), Expect = 0.37 Identities = 13/22 (59%), Positives = 22/22 (100%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +++RQA+ITTEL+EI++GA+A+ Sbjct: 270 NKSRQAAITTELSEIVAGAAAV 291
>ATPG_NEIMA (Q9JW71) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 32.3 bits (72), Expect = 0.37 Identities = 13/22 (59%), Positives = 22/22 (100%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +++RQA+ITTEL+EI++GA+A+ Sbjct: 270 NKSRQAAITTELSEIVAGAAAV 291
>ATPG_NEIG1 (Q5F4Z1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 32.3 bits (72), Expect = 0.37 Identities = 13/22 (59%), Positives = 22/22 (100%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +++RQA+ITTEL+EI++GA+A+ Sbjct: 270 NKSRQAAITTELSEIVAGAAAV 291
>ATPG_BUCAP (O51873) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 32.3 bits (72), Expect = 0.37 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT ELTEI++GASA+ Sbjct: 267 NKVRQANITQELTEIVAGASAV 288
>ATPG_FUSNN (Q8RGE1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 282 Score = 32.3 bits (72), Expect = 0.37 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQ++IT E+TEI+ GASAL Sbjct: 261 NRNRQSAITQEITEIVGGASAL 282
>ATPG_GLUOX (Q5FRC6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 296 Score = 32.3 bits (72), Expect = 0.37 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +RTRQA+IT +L EIISGA A+ Sbjct: 275 NRTRQANITNDLIEIISGAEAV 296
>ATPG_VIBF1 (Q5E1N6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 32.0 bits (71), Expect = 0.48 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+SGASA+ Sbjct: 267 NKARQAAITQELSEIVSGASAV 288
>ATPG_CHRVO (Q7P096) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 32.0 bits (71), Expect = 0.48 Identities = 13/22 (59%), Positives = 21/22 (95%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+ITTEL+EI++GA+A+ Sbjct: 267 NKARQAAITTELSEIVAGAAAV 288
>ATPG1_PHOPR (Q6LLG7) ATP synthase gamma chain 1 (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit 1) Length = 288 Score = 32.0 bits (71), Expect = 0.48 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+SGASA+ Sbjct: 267 NKARQAAITQELSEIVSGASAV 288
>ATPG_SILPO (Q5LNP0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 32.0 bits (71), Expect = 0.48 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQA IT EL EIISGA AL Sbjct: 270 NRSRQAVITNELIEIISGAEAL 291
>ATPG_YEAST (P38077) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 311 Score = 32.0 bits (71), Expect = 0.48 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +RTRQA IT EL +II+GAS+L Sbjct: 289 NRTRQAVITNELVDIITGASSL 310
>ATPG_SHEON (Q8E8B9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 32.0 bits (71), Expect = 0.48 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+SGASA+ Sbjct: 265 NKARQAAITQELSEIVSGASAV 286
>ATPG_OENOE (Q8KM29) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 303 Score = 32.0 bits (71), Expect = 0.48 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+ITTE+TEI G +AL+ Sbjct: 281 NRARQAAITTEITEITGGMAALQ 303
>ATPG_CORDI (Q6NHT0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 325 Score = 31.6 bits (70), Expect = 0.63 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA IT E+TEI+ GASAL Sbjct: 297 NQARQAQITQEITEIVGGASAL 318
>ATPG_STAHJ (Q4L7Y5) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA IT ++TEI+ G++ALE Sbjct: 266 NRARQAEITQQITEIVGGSAALE 288
>ATPG_STAAW (Q7A0C5) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA IT ++TEI+ G++ALE Sbjct: 266 NRARQAEITQQITEIVGGSAALE 288
>ATPG_STAAS (Q6G7K6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA IT ++TEI+ G++ALE Sbjct: 266 NRARQAEITQQITEIVGGSAALE 288
>ATPG_STAAR (Q6GEX1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA IT ++TEI+ G++ALE Sbjct: 266 NRARQAEITQQITEIVGGSAALE 288
>ATPG_STAAN (Q7A4E8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA IT ++TEI+ G++ALE Sbjct: 266 NRARQAEITQQITEIVGGSAALE 288
>ATPG_STAAM (Q99SF4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA IT ++TEI+ G++ALE Sbjct: 266 NRARQAEITQQITEIVGGSAALE 288
>ATPG_STAAC (Q5HE96) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA IT ++TEI+ G++ALE Sbjct: 266 NRARQAEITQQITEIVGGSAALE 288
>ATPG_PELUB (Q4FP37) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 31.6 bits (70), Expect = 0.63 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQA+IT EL EIISGA +L Sbjct: 270 NRSRQAAITKELIEIISGAESL 291
>ATPG_CORJK (Q4JUJ9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 326 Score = 31.6 bits (70), Expect = 0.63 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA IT E+TEI+ GASAL Sbjct: 298 NQARQAQITQEITEIVGGASAL 319
>ATPG_COREF (Q8FQ21) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 326 Score = 31.6 bits (70), Expect = 0.63 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -2 Query: 116 RQASITTELTEIISGASALEG 54 RQA IT E+TEI+ GA AL G Sbjct: 301 RQAQITQEITEIVGGAGALSG 321
>ATPG_BUCAI (P57123) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 31.6 bits (70), Expect = 0.63 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL EI+SGASA+ Sbjct: 266 NKVRQANITQELNEIVSGASAV 287
>ATPG_BRUSU (Q8FYR4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 31.6 bits (70), Expect = 0.63 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT EL EIISGA AL Sbjct: 271 NRQRQAQITKELIEIISGAEAL 292
>ATPG_BRUME (Q8YJ36) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 31.6 bits (70), Expect = 0.63 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT EL EIISGA AL Sbjct: 271 NRQRQAQITKELIEIISGAEAL 292
>ATPG_BRUAB (Q57B87) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 31.6 bits (70), Expect = 0.63 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT EL EIISGA AL Sbjct: 271 NRQRQAQITKELIEIISGAEAL 292
>ATPG_AGRT5 (Q8UC75) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 292 Score = 31.6 bits (70), Expect = 0.63 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT EL EIISGA AL Sbjct: 271 NRQRQAQITKELIEIISGAEAL 292
>ATPG_RHIME (Q92LK7) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 294 Score = 31.6 bits (70), Expect = 0.63 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT EL EIISGA AL Sbjct: 273 NRQRQAQITKELIEIISGAEAL 294
>ATPG_RHILO (Q98EV7) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 294 Score = 31.6 bits (70), Expect = 0.63 Identities = 16/22 (72%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT EL EIISGA AL Sbjct: 273 NRQRQAQITKELIEIISGAEAL 294
>ATPG_BACST (P42007) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++G +AL+ Sbjct: 265 NRARQAAITQEITEIVAGRNALQ 287
>ATPG_BACCA (P41010) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 31.6 bits (70), Expect = 0.63 Identities = 13/23 (56%), Positives = 20/23 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+TEI++G +AL+ Sbjct: 265 NRARQAAITQEITEIVAGRNALQ 287
>ATPG_RALSO (Q8XU75) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 31.2 bits (69), Expect = 0.82 Identities = 13/22 (59%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++TRQA+IT EL+EI+ GA+A+ Sbjct: 270 NKTRQAAITKELSEIVGGAAAV 291
>ATPG_HAEDU (Q7VPP1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 31.2 bits (69), Expect = 0.82 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT EL EI++GA+A+ Sbjct: 267 NKARQASITNELNEIVAGAAAI 288
>ATPG_CAUCR (Q9A2V8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 31.2 bits (69), Expect = 0.82 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQA IT EL EIISGA A+ Sbjct: 270 NRSRQAQITKELIEIISGAEAV 291
>ATPG_MOOTA (O05432) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 282 Score = 31.2 bits (69), Expect = 0.82 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT E+ EI++GA AL+ Sbjct: 260 NRARQAAITNEIVEIVAGADALK 282
>ATPG_CLOAB (Q9Z688) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 282 Score = 31.2 bits (69), Expect = 0.82 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -2 Query: 149 LTVLH*HTDRTRQASITTELTEIISGASALE 57 L L+ +R RQ++IT E+TEI+ GA AL+ Sbjct: 252 LDALNIKYNRIRQSAITQEITEIVGGAEALK 282
>ATPG_PASMU (Q9L6B6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 31.2 bits (69), Expect = 0.82 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT EL EI++GA+A+ Sbjct: 268 NKARQASITNELNEIVAGAAAI 289
>ATPG_MANSM (Q65Q06) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 31.2 bits (69), Expect = 0.82 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT EL EI++GA+A+ Sbjct: 268 NKARQASITNELNEIVAGAAAI 289
>ATPG_HAEIN (P43716) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 31.2 bits (69), Expect = 0.82 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT EL EI++GA+A+ Sbjct: 268 NKARQASITNELNEIVAGAAAI 289
>ATPG_HAEI8 (Q4QN63) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 31.2 bits (69), Expect = 0.82 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQASIT EL EI++GA+A+ Sbjct: 268 NKARQASITNELNEIVAGAAAI 289
>ATPG_STAS1 (Q49Z51) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.8 bits (68), Expect = 1.1 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+IT ++TEI+ G+ ALE Sbjct: 266 NRARQAAITQQITEIVGGSVALE 288
>ATPG_WOLPM (Q73FU0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 30.8 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQA+ITT+L E+I GA +L Sbjct: 269 NRSRQAAITTDLIEVIGGAESL 290
>ATPG_DECAR (Q477Z2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 30.8 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+SGA+A+ Sbjct: 265 NKARQAAITKELSEIVSGAAAV 286
>ATPG_RHOBA (Q7UFB6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 296 Score = 30.8 bits (68), Expect = 1.1 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALEG 54 +R RQ+ IT E+ EII G ALEG Sbjct: 273 NRARQSQITGEIMEIIGGVEALEG 296
>ATPG_PROAC (Q6A8C6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 314 Score = 30.8 bits (68), Expect = 1.1 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E+TEI+ GA+AL Sbjct: 286 NQARQAAITQEITEIVGGAAAL 307
>ATPG_VIBPA (Q87KA7) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+ GASA+ Sbjct: 267 NKARQAAITQELSEIVGGASAV 288
>ATPG_RICFE (Q4UK17) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.4 bits (67), Expect = 1.4 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQA ITTEL EII+G+ A+ Sbjct: 267 NRSRQAIITTELIEIIAGSEAV 288
>ATPG_CLOPA (Q93Q45) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 281 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASA 63 +R RQ++IT E+TEI+SGA A Sbjct: 259 NRIRQSAITQEITEIVSGAEA 279
>ATPG_BLOPB (Q494C4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQ IT ELTEI+SGAS + Sbjct: 267 NKARQTKITEELTEIVSGASVI 288
>ATPG_BUCSC (Q9RQ77) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 30.4 bits (67), Expect = 1.4 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQ +IT ELTEIISGA+A+ Sbjct: 266 NKARQDNITQELTEIISGANAV 287
>ATPG_BORPE (Q7VU45) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 301 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++TRQA+IT E++EI+ GA+A+ Sbjct: 280 NKTRQAAITKEISEIVGGAAAV 301
>ATPG_BORPA (Q7W3A9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 301 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++TRQA+IT E++EI+ GA+A+ Sbjct: 280 NKTRQAAITKEISEIVGGAAAV 301
>ATPG_BORBR (Q7WEM8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 301 Score = 30.4 bits (67), Expect = 1.4 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++TRQA+IT E++EI+ GA+A+ Sbjct: 280 NKTRQAAITKEISEIVGGAAAV 301
>ATPG_BUCMH (Q9RQ74) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 30.4 bits (67), Expect = 1.4 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQ +IT ELTEI+SGA+A+ Sbjct: 265 NKARQDNITQELTEIVSGAAAI 286
>ATPG_MYCLE (P45824) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 298 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT E++EI+ GA+AL Sbjct: 273 NRERQAQITQEISEIVGGANAL 294
>ATPG_BIFLO (Q8G7B2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 307 Score = 30.0 bits (66), Expect = 1.8 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -2 Query: 119 TRQASITTELTEIISGASAL 60 +RQASIT ELTEII A AL Sbjct: 283 SRQASITQELTEIIGSADAL 302
>ATPG_CORGL (Q79VG6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 325 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA IT E+TEI+ GA AL Sbjct: 297 NQARQAQITQEITEIVGGAGAL 318
>ATPG_RICTY (Q68VU7) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.0 bits (66), Expect = 1.8 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQ ITTEL EII+GA A+ Sbjct: 267 NRSRQTIITTELIEIIAGAEAV 288
>ATPG_RICPR (O50289) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.0 bits (66), Expect = 1.8 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQ ITTEL EII+GA A+ Sbjct: 267 NRSRQTIITTELIEIIAGAEAV 288
>ATPG_MYCTU (P63671) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 305 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT E++EI+ GA+AL Sbjct: 280 NRERQAQITQEISEIVGGANAL 301
>ATPG_MYCBO (P63672) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 305 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT E++EI+ GA+AL Sbjct: 280 NRERQAQITQEISEIVGGANAL 301
>ATPG_LEGPL (Q5WSG7) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL EI+ GA+AL Sbjct: 267 NKARQAAITQELAEIVGGAAAL 288
>ATPG_LEGPH (Q5ZRA0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL EI+ GA+AL Sbjct: 267 NKARQAAITQELAEIVGGAAAL 288
>ATPG_LEGPA (Q5X0P2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL EI+ GA+AL Sbjct: 267 NKARQAAITQELAEIVGGAAAL 288
>ATPG_MYCPA (Q73X58) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 304 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT E++EI+ GA+AL Sbjct: 279 NRERQAQITQEISEIVGGANAL 300
>ATPG_SCHPO (O74754) ATP synthase gamma chain, mitochondrial precursor (EC| 3.6.3.14) Length = 301 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQASIT EL +I++GA++L Sbjct: 279 NRQRQASITNELIDIVTGANSL 300
>ATPG2_ARATH (Q01909) ATP synthase gamma chain 2, chloroplast precursor (EC| 3.6.3.14) Length = 386 Score = 30.0 bits (66), Expect = 1.8 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT EL EI++GA AL Sbjct: 362 NRARQAKITGELLEIVAGAEAL 383
>ATPG_COXBU (Q83AF6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 ++ RQA IT E+ EI++GA+A+E Sbjct: 267 NKARQAGITREIAEIVAGAAAVE 289
>ATPG_XANOR (Q5H4Y5) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+SGA+A+ Sbjct: 266 NKARQAAITQEISEIVSGAAAV 287
>ATPG_XANCP (Q8PCZ6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+SGA+A+ Sbjct: 266 NKARQAAITQEISEIVSGAAAV 287
>ATPG_XANC8 (Q4UQF3) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+SGA+A+ Sbjct: 266 NKARQAAITQEISEIVSGAAAV 287
>ATPG_XANAC (Q8PGG6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 30.0 bits (66), Expect = 1.8 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+SGA+A+ Sbjct: 266 NKARQAAITQEISEIVSGAAAV 287
>ATPG_GLOVI (Q7NDC0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 314 Score = 30.0 bits (66), Expect = 1.8 Identities = 14/29 (48%), Positives = 23/29 (79%) Frame = -2 Query: 149 LTVLH*HTDRTRQASITTELTEIISGASA 63 LT+++ ++ RQASIT E+ E++SGA+A Sbjct: 289 LTIVY---NKARQASITQEILEVVSGANA 314
>ATPG_EHRRW (Q5HBD0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 283 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R+RQA+ITT+L E+ISG +L Sbjct: 259 NRSRQAAITTDLIEVISGFESL 280
>ATPG_BURPS (Q63PH9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 29.6 bits (65), Expect = 2.4 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +++RQA+IT EL+EI+ GA+A+ Sbjct: 270 NKSRQAAITKELSEIVGGAAAV 291
>ATPG_BURMA (Q62FR6) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 291 Score = 29.6 bits (65), Expect = 2.4 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +++RQA+IT EL+EI+ GA+A+ Sbjct: 270 NKSRQAAITKELSEIVGGAAAV 291
>ATPG_CHLRE (P12113) ATP synthase gamma chain, chloroplast precursor (EC| 3.6.3.14) Length = 358 Score = 29.6 bits (65), Expect = 2.4 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALEG 54 ++ RQA IT EL EI+ GA+A G Sbjct: 335 NKQRQAKITQELAEIVGGAAATSG 358
>ATPG_NITEU (Q82XP9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 294 Score = 29.6 bits (65), Expect = 2.4 Identities = 12/22 (54%), Positives = 20/22 (90%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +++RQA+IT EL+EI+ GA+A+ Sbjct: 273 NKSRQAAITKELSEIVGGAAAV 294
>ATPG_CAMJR (Q5HX60) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 294 Score = 29.6 bits (65), Expect = 2.4 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 ++ RQ SITTEL EIISG +++ Sbjct: 272 NKARQESITTELIEIISGVESMK 294
>ATPG_CAMJE (Q9PJ20) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 294 Score = 29.6 bits (65), Expect = 2.4 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 ++ RQ SITTEL EIISG +++ Sbjct: 272 NKARQESITTELIEIISGVESMK 294
>ATPG_LACPL (Q88UU2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 314 Score = 29.6 bits (65), Expect = 2.4 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASALE 57 +R RQA+ITTE+TEI G A E Sbjct: 292 NRARQAAITTEITEITGGLVAQE 314
>ATPG_IDILO (Q5QZI5) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 29.6 bits (65), Expect = 2.4 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+SGA A+ Sbjct: 266 NKARQAAITQEISEIVSGAEAV 287
>ATPG_VIBVY (Q7MGH9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+ GA+A+ Sbjct: 267 NKARQAAITQELSEIVGGAAAV 288
>ATPG_VIBVU (Q8DDG9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+ GA+A+ Sbjct: 267 NKARQAAITQELSEIVGGAAAV 288
>ATPG_VIBCH (Q9KNH4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+ GA+A+ Sbjct: 267 NKARQAAITQELSEIVGGAAAV 288
>ATPG_VIBAL (P12990) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 288 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL+EI+ GA+A+ Sbjct: 267 NKARQAAITQELSEIVGGAAAV 288
>ATPG_STRLI (P50007) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 302 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 116 RQASITTELTEIISGASAL 60 RQA IT E++EI+ GASAL Sbjct: 275 RQAEITQEISEIVGGASAL 293
>ATPG_STRCO (Q9K4D4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 305 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 116 RQASITTELTEIISGASAL 60 RQA IT E++EI+ GASAL Sbjct: 278 RQAEITQEISEIVGGASAL 296
>ATPG_STRAW (Q82J83) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 305 Score = 29.3 bits (64), Expect = 3.1 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 116 RQASITTELTEIISGASAL 60 RQA IT E++EI+ GASAL Sbjct: 278 RQAEITQEISEIVGGASAL 296
>ATPG_LEPIC (Q72SY0) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/22 (54%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT E++EI++GA +L Sbjct: 264 NRVRQAKITQEISEIVAGADSL 285
>ATPG_THETN (Q8RC16) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 295 Score = 29.3 bits (64), Expect = 3.1 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -2 Query: 149 LTVLH*HTDRTRQASITTELTEIISGAS 66 LT+L+ ++ RQASIT E+ EII+GAS Sbjct: 270 LTLLY---NKLRQASITQEIIEIITGAS 294
>ATPG_TOBAC (P29790) ATP synthase gamma chain, chloroplast precursor (EC| 3.6.3.14) Length = 377 Score = 28.9 bits (63), Expect = 4.1 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 +R RQA IT E+ EI++GA AL Sbjct: 355 NRQRQAKITGEILEIVAGADAL 376
>ATPG_MYCMS (Q6MS93) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 280 Score = 28.9 bits (63), Expect = 4.1 Identities = 12/21 (57%), Positives = 18/21 (85%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASA 63 +R RQ +IT E++EI+SGA+A Sbjct: 258 NRQRQGAITQEISEIVSGANA 278
>ATPG_WOLTR (Q5GRT1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 290 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/20 (60%), Positives = 17/20 (85%) Frame = -2 Query: 119 TRQASITTELTEIISGASAL 60 +RQA+ITT+L E+I GA +L Sbjct: 271 SRQAAITTDLIEVIGGAESL 290
>ATPG_NOCFA (Q5Z0Y2) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 323 Score = 28.5 bits (62), Expect = 5.3 Identities = 13/29 (44%), Positives = 19/29 (65%) Frame = -2 Query: 146 TVLH*HTDRTRQASITTELTEIISGASAL 60 +VL + RQA IT E++EI+ G +AL Sbjct: 288 SVLQREANSVRQAQITQEISEIVGGVNAL 316
>ATPG_PSEU2 (Q4ZL23) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 265 NKARQAAITQEISEIVGGAAAV 286
>ATPG_PSESM (Q87TT3) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 265 NKARQAAITQEISEIVGGAAAV 286
>ATPG_PSEPK (Q88BX3) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 265 NKARQAAITQEISEIVGGAAAV 286
>ATPG_PSEF5 (Q4K3A8) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 265 NKARQAAITQEISEIVGGAAAV 286
>ATPG_PSEAE (Q9HT19) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 265 NKARQAAITQEISEIVGGAAAV 286
>ATPG_PSE14 (Q48BG4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 265 NKARQAAITQEISEIVGGAAAV 286
>ATPG_MYCPE (Q8EWY9) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 286 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -2 Query: 125 DRTRQASITTELTEIISGA 69 +R RQ+ IT E+TEI+SGA Sbjct: 265 NRKRQSEITQEITEIVSGA 283
>ATPG_XYLFT (Q87E89) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 266 NKARQAAITQEISEIVGGAAAV 287
>ATPG_XYLFA (Q9PE84) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 28.5 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 266 NKARQAAITQEISEIVGGAAAV 287
>ATPG_COLP3 (Q48AW1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL EI++GA+A+ Sbjct: 265 NKARQAAITQELGEIVAGAAAV 286
>ATPG_COLMA (Q8VV78) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 28.5 bits (62), Expect = 5.3 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT EL EI++GA+A+ Sbjct: 265 NKARQAAITQELGEIVAGAAAV 286
>ATPG_FRATT (Q5NIK4) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 298 Score = 28.1 bits (61), Expect = 6.9 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA IT EL EI SGA+A+ Sbjct: 277 NKVRQAMITQELAEICSGAAAV 298
>ATPG_PSYAR (Q4FQ36) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 293 Score = 28.1 bits (61), Expect = 6.9 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 271 NKLRQAAITREISEIVGGAAAV 292
>ATPG_SPIOL (P05435) ATP synthase gamma chain, chloroplast precursor (EC| 3.6.3.14) Length = 364 Score = 28.1 bits (61), Expect = 6.9 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASA 63 +R RQA IT E+ EI++GA+A Sbjct: 342 NRARQAKITGEILEIVAGANA 362
>ATPG_ACIAD (Q6FFK1) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 289 Score = 28.1 bits (61), Expect = 6.9 Identities = 11/22 (50%), Positives = 19/22 (86%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E++EI+ GA+A+ Sbjct: 268 NKLRQAAITQEISEIVGGAAAV 289
>ATPG_METCA (Q60CR5) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 287 Score = 28.1 bits (61), Expect = 6.9 Identities = 11/22 (50%), Positives = 18/22 (81%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASAL 60 ++ RQA+IT E+ EI+ GA+A+ Sbjct: 266 NKARQAAITQEIAEIVGGAAAV 287
>ATPG1_ARATH (Q01908) ATP synthase gamma chain 1, chloroplast precursor (EC| 3.6.3.14) Length = 373 Score = 27.7 bits (60), Expect = 9.0 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -2 Query: 125 DRTRQASITTELTEIISGASA 63 +R RQA IT E+ EI++GA+A Sbjct: 351 NRKRQAKITGEILEIVAGANA 371 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,560,071 Number of Sequences: 219361 Number of extensions: 265844 Number of successful extensions: 994 Number of sequences better than 10.0: 197 Number of HSP's better than 10.0 without gapping: 979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 994 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
