ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags12e10 |
|---|---|
| Clone Library Name | barley_pub |
>DISC_DROME (P23792) Protein disconnected| Length = 568 Score = 32.0 bits (71), Expect = 0.59 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +1 Query: 94 ILYHAQHTHKMFHRALKTHPSNHPHSPQNAPGLPSKS 204 +L H H+H+ H L +HP + SP ++PG S S Sbjct: 14 LLGHGPHSHQHVHSHLPSHPQPNAASPASSPGGSSGS 50
>NUP98_HUMAN (P52948) Nuclear pore complex protein Nup98-Nup96 precursor| [Contains: Nuclear pore complex protein Nup98 (Nucleoporin Nup98) (98 kDa nucleoporin); Nuclear pore complex protein Nup96 (Nucleoporin Nup96) (96 kDa nucleoporin)] Length = 1729 Score = 30.8 bits (68), Expect = 1.3 Identities = 22/71 (30%), Positives = 29/71 (40%), Gaps = 5/71 (7%) Frame = +2 Query: 218 SPRLPIIN*HKSWNRRT-----GNKITAGTLLSPQPPWKKTLAPGHGGLWRPNQTSNWIS 382 SPRLPI H S R +K T+G LSP ++ P L TS+W Sbjct: 1028 SPRLPISASHSSKTRSLVGGLLQSKFTSGAFLSPSVSVQECRTPRAASLMNIPSTSSWSV 1087 Query: 383 NAESQSTMSLP 415 S ++P Sbjct: 1088 PPPLTSVFTMP 1098
>APC_XENLA (P70039) Adenomatous polyposis coli homolog (Protein APC)| Length = 2829 Score = 30.8 bits (68), Expect = 1.3 Identities = 19/58 (32%), Positives = 31/58 (53%), Gaps = 7/58 (12%) Frame = +2 Query: 257 NRRTGNKITAGTLLSPQP-------PWKKTLAPGHGGLWRPNQTSNWISNAESQSTMS 409 N R+G++ +A + SPQP P + +++PG G+ PN+ S + S ST S Sbjct: 2297 NSRSGSRDSASSRPSPQPLSRPLQSPGRNSISPGKNGISPPNKFSQ-LPRTTSPSTAS 2353
>SRY_BOSMU (Q9XS37) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H SW NK+T T +S P+ K+L PG Sbjct: 191 HSSWTSLGHNKVTLATRISADFPFNKSLEPG 221
>SRY_BOSJA (Q8SPQ1) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H SW NK+T T +S P+ K+L PG Sbjct: 191 HSSWTSLGHNKVTLATRISADFPFNKSLEPG 221
>SRY_BOSIN (Q7JGF7) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H SW NK+T T +S P+ K+L PG Sbjct: 191 HSSWTSLGHNKVTLATRISADFPFNKSLEPG 221
>SRY_BOSGF (Q7JGF9) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H SW NK+T T +S P+ K+L PG Sbjct: 191 HSSWTSLGHNKVTLATRISADFPFNKSLEPG 221
>SRY_BISBO (Q27949) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H SW NK+T T +S P+ K+L PG Sbjct: 191 HSSWTSLGHNKVTLATRISADFPFNKSLEPG 221
>SRY_BISBI (Q8SPQ2) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 30.8 bits (68), Expect = 1.3 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H SW NK+T T +S P+ K+L PG Sbjct: 191 HSSWTSLGHNKVTLATRISADFPFNKSLEPG 221
>YL52_CAEEL (P34431) Hypothetical protein F44E2.2 in chromosome III| Length = 2186 Score = 30.0 bits (66), Expect = 2.3 Identities = 21/102 (20%), Positives = 34/102 (33%) Frame = +2 Query: 29 IDTS*YSHQIYXTKLTIKDQHPYYIMLSTRTKCFTEHLKHIHLTIHTAHKMLQACRANLA 208 +DT +H ++ I+ H + + +C L + A + N Sbjct: 436 MDTDEINHYDVCREMIIR--HEWNVSKINEKQCLNSKLSEKRGKVQNAENFVNQNTQNNF 493 Query: 209 AKLSPRLPIIN*HKSWNRRTGNKITAGTLLSPQPPWKKTLAP 334 SP N SWN + N A +S + WK P Sbjct: 494 KPFSPNKAADNSRNSWNNNSQNNSAASQNISREQSWKTISVP 535
>SRY_BUBBU (Q69FB1) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 29.6 bits (65), Expect = 2.9 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H SW N++T T +S P+ K+L PG Sbjct: 191 HSSWTSLGHNRVTLATRISEDFPFNKSLEPG 221
>SRY_BOVIN (Q03255) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 29.6 bits (65), Expect = 2.9 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H SW NK+T T +S P K+L PG Sbjct: 191 HSSWTSLGHNKVTLATRISADFPCNKSLEPG 221
>SLIK5_MOUSE (Q810B7) SLIT and NTRK-like protein 5 precursor| Length = 957 Score = 29.3 bits (64), Expect = 3.8 Identities = 19/67 (28%), Positives = 30/67 (44%) Frame = +1 Query: 118 HKMFHRALKTHPSNHPHSPQNAPGLPSKSCGKIESTPPYHQLAQILESPNRK*NYSRHPX 297 +K H T+ SNH H Q P P + + PP Q E R+ ++ R P Sbjct: 777 YKDLHELKVTYSSNH-HLQQQPPPPPQQP----QQQPPPQMQMQPGEEERRESHHLRSPA 831 Query: 298 FTTTTLE 318 ++ +T+E Sbjct: 832 YSVSTIE 838
>ZIC2_XENLA (Q91689) Zinc finger protein ZIC 2 (Zinc finger protein of the| cerebellum 2) (Zinc finger DNA-binding protein fZic) Length = 501 Score = 29.3 bits (64), Expect = 3.8 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +1 Query: 136 ALKTHPSNHPHSPQNAPGLPSKSCGKIESTPPYHQLAQILESPNRK-*NYSRHPXFTTTT 312 +L+ H H SPQ + P+ S G STPP L SPN + N + P + Sbjct: 426 SLRKHMKVHESSPQGSESSPAASSGYESSTPPG------LVSPNSETQNPNLSPAAAAVS 479 Query: 313 LEENSGSG 336 N SG Sbjct: 480 AVHNVSSG 487
>CDX2_MESAU (Q04649) Homeobox protein CDX-2 (Caudal-type homeobox protein 2)| Length = 313 Score = 29.3 bits (64), Expect = 3.8 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +1 Query: 100 YHAQHTHKMFHRALKTHPSNHPHSPQNAPGLPSKSCGKIESTPP 231 YHA H HP +HPH P AP S + PP Sbjct: 112 YHAHH-----------HPHHHPHHPAAAPSCASGLLQTLNPGPP 144
>LE756_CAEEL (Q11184) Protein let-756 (Lethal protein 756)| Length = 425 Score = 28.9 bits (63), Expect = 5.0 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +1 Query: 148 HPSNHPHSPQNAPGLPSKSCGKIESTPPYHQLAQILESPNRK-*NYSRHP 294 H S+H H + P + S S + H LAQ + +PNR+ NY R+P Sbjct: 378 HNSHHHH--HHHPRVSSSSDPQQRHQSQQHYLAQTVSNPNRQNVNYQRYP 425
>ZIC2_HUMAN (O95409) Zinc finger protein ZIC 2 (Zinc finger protein of the| cerebellum 2) Length = 532 Score = 28.9 bits (63), Expect = 5.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 136 ALKTHPSNHPHSPQNAPGLPSKSCGKIESTPP 231 +L+ H H SPQ + P+ S G STPP Sbjct: 407 SLRKHMKVHESSPQGSESSPAASSGYESSTPP 438
>ZIC2_MOUSE (Q62520) Zinc finger protein ZIC 2 (Zinc finger protein of the| cerebellum 2) Length = 530 Score = 28.9 bits (63), Expect = 5.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 136 ALKTHPSNHPHSPQNAPGLPSKSCGKIESTPP 231 +L+ H H SPQ + P+ S G STPP Sbjct: 407 SLRKHMKVHESSPQGSESSPAASSGYESSTPP 438
>RIR1_CAEEL (Q03604) Ribonucleoside-diphosphate reductase large subunit (EC| 1.17.4.1) (Ribonucleotide reductase large chain) Length = 788 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +1 Query: 115 THKMFHRALKT-HPSNHPHSPQNAPGLPSKSCGKIE 219 T+K+F +KT H +HPH+ ++AP + ++ IE Sbjct: 96 TNKVFSEVMKTLHEFHHPHTGKHAPMISDETWAIIE 131
>SRY_AXIPR (Q863C2) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 28.5 bits (62), Expect = 6.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +2 Query: 245 HKSWNRRTGNKITAGTLLSPQPPWKKTLAPG 337 H+SW N++T T +S P+ ++L PG Sbjct: 191 HRSWTNLGHNRVTLATQISADFPFYQSLQPG 221
>V70K_OYMV (P20130) 66 kDa protein| Length = 597 Score = 28.1 bits (61), Expect = 8.6 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +1 Query: 121 KMFHRALKTHPSNHPHSPQNAPGLPSKS--CGKIESTPPYHQLAQILESP 264 K+ HR L H H+ + L S+ C K+ TP +QLAQ + P Sbjct: 178 KLLHRPLSPPKPLHLHNFRQHSSLCSRRSPCRKLRPTPRCNQLAQAQQHP 227
>SRBS1_HUMAN (Q9BX66) Sorbin and SH3 domain-containing protein 1 (Ponsin)| (c-Cbl-associated protein) (CAP) (SH3 domain protein 5) (SH3P12) Length = 1292 Score = 28.1 bits (61), Expect = 8.6 Identities = 23/80 (28%), Positives = 32/80 (40%), Gaps = 9/80 (11%) Frame = +2 Query: 203 LAAKLSPRLPIIN*HKSWNRRTGNKITAGTLLSPQPPWKKTLAP---------GHGGLWR 355 L+ + SP L + H SW+ R + A L P P +LAP G GG+ Sbjct: 1023 LSPRASPSLSLSLPHLSWSDRPTPRSVASPLALPSPHKTYSLAPTSQASLHMNGDGGVHT 1082 Query: 356 PNQTSNWISNAESQSTMSLP 415 P+ S S + LP Sbjct: 1083 PS------SGIHQDSFLQLP 1096
>LOXB_LYCES (P38416) Lipoxygenase B (EC 1.13.11.12)| Length = 859 Score = 28.1 bits (61), Expect = 8.6 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = +2 Query: 203 LAAKLSPRLPIIN*HKSWNRRTGNKITAGTLLSPQPPWKKTLAPGHGGLWRPNQTS 370 + + + R+ I+N HKSW R+G TLL P T G G PN S Sbjct: 809 MLSDIENRIMIMNSHKSWKNRSGPVNVPYTLLFP------TSEEGLTGKGIPNSVS 858
>FOXB2_MOUSE (Q64733) Forkhead box protein B2 (Transcription factor FKH-4)| Length = 428 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/29 (37%), Positives = 13/29 (44%) Frame = +1 Query: 100 YHAQHTHKMFHRALKTHPSNHPHSPQNAP 186 +HA H H H A H +HP P P Sbjct: 142 HHAHHHHHHHHHAAHHHHHHHPPQPPPPP 170
>MDR2_ARATH (Q8LPK2) Multidrug resistance protein 2 (P-glycoprotein 2)| Length = 1233 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 316 PGWLW*KXGACCNFISGSAIPRFVL 242 P W++ G C FI+GS +P F L Sbjct: 665 PDWMYGVCGTICAFIAGSQMPLFAL 689
>SPAG8_HUMAN (Q99932) Sperm-associated antigen 8 (Sperm membrane protein 1)| (SMP-1) (HSD-1) (Sperm membrane protein BS-84) Length = 426 Score = 28.1 bits (61), Expect = 8.6 Identities = 11/20 (55%), Positives = 14/20 (70%), Gaps = 2/20 (10%) Frame = +2 Query: 305 QPPWK--KTLAPGHGGLWRP 358 QPPW+ + L PG GLW+P Sbjct: 242 QPPWEFLQVLEPGARGLWKP 261 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,137,675 Number of Sequences: 219361 Number of extensions: 1248406 Number of successful extensions: 3583 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 3386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3562 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
