| Clone Name | rbags12d22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL15_THEFY (Q47LL2) 50S ribosomal protein L15 | 30 | 5.4 | 2 | CC14B_MOUSE (Q6PFY9) Dual specificity protein phosphatase CDC14B... | 30 | 7.1 |
|---|
>RL15_THEFY (Q47LL2) 50S ribosomal protein L15| Length = 149 Score = 30.0 bits (66), Expect = 5.4 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = -2 Query: 598 IYCVYNQPTLGKLMYVDENLVTVGDTLCIGYARLDSPEKRKGSGNLKIVLRI 443 +Y V N L KL Y + VT+ D + G R + P K G+G + + +R+ Sbjct: 76 VYQVVNLDKLSKL-YPEGGEVTIEDLVAKGAVRKNQPVKVLGTGEISVPVRV 126
>CC14B_MOUSE (Q6PFY9) Dual specificity protein phosphatase CDC14B (EC 3.1.3.48)| (EC 3.1.3.16) (CDC14 cell division cycle 14 homolog B) Length = 485 Score = 29.6 bits (65), Expect = 7.1 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = -3 Query: 414 FDHEALFLTVIRGSRIPGEKITQYCLDLCEH*AGALA 304 FDH LF P E I Q LD+CE+ GA+A Sbjct: 278 FDHHDLFFP---DGSTPAESIVQEFLDICENVKGAIA 311 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,651,563 Number of Sequences: 219361 Number of extensions: 1832478 Number of successful extensions: 3843 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3764 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3842 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)