| Clone Name | rbags12c20 |
|---|---|
| Clone Library Name | barley_pub |
>SREC2_HUMAN (Q96GP6) Scavenger receptor class F member 2 precursor (Scavenger| receptor expressed by endothelial cells 2 protein) (SREC-II) (SRECRP-1) Length = 866 Score = 31.6 bits (70), Expect = 0.47 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = -2 Query: 393 FGLSCCHPCYCALQNHFRWQEGSGTCEA----RCCGEEAQCHGSRC 268 +G C CYC+ + Q G+ C A R C + C+ S C Sbjct: 177 WGAQCASACYCSATSRCDPQTGACLCHAGWWGRSCNNQCACNSSPC 222
>KRA56_HUMAN (Q6L8G9) Keratin-associated protein 5-6 (Keratin-associated protein| 5.6) (Ultrahigh sulfur keratin-associated protein 5.6) Length = 129 Score = 30.8 bits (68), Expect = 0.80 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCC 301 SCC PCYC+ GS C++ CC Sbjct: 89 SCCKPCYCSSGC------GSSCCQSSCC 110
>ZNF77_HUMAN (Q15935) Zinc finger protein 77 (ZNFpT1)| Length = 545 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 369 CYCALQNHFRWQEGSGTCEARCCGEEAQCHGS 274 CY + ++H R G C+ + CG+ C+ S Sbjct: 307 CYSSFRDHVRTHTGEKPCQCKHCGKAFTCYSS 338
>KRA52_HUMAN (Q701N4) Keratin-associated protein 5-2 (Keratin-associated protein| 5.2) (Ultrahigh sulfur keratin-associated protein 5.2) (Keratin-associated protein 5-8) (Keratin-associated protein 5.8) Length = 177 Score = 28.9 bits (63), Expect = 3.1 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC PC C+ GS C++ CC + C S C Sbjct: 117 SCCKPCCCSSGC------GSSCCQSSCC-KPCCCQSSCC 148
>LAMB1_HUMAN (P07942) Laminin beta-1 chain precursor (Laminin B1 chain)| Length = 1786 Score = 28.9 bits (63), Expect = 3.1 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = -2 Query: 399 FDFGLSCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCH 280 F FG S C PC C LQ G+ A C QCH Sbjct: 811 FGFGPSGCKPCECHLQ---------GSVNAFCNPVTGQCH 841
>KRA54_HUMAN (Q6L8H1) Keratin-associated protein 5-4 (Keratin-associated protein| 5.4) (Ultrahigh sulfur keratin-associated protein 5.4) Length = 288 Score = 28.5 bits (62), Expect = 4.0 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC PC C+ GS C++ CC + C S C Sbjct: 200 SCCKPCCCSSGC------GSSCCQSSCC--KPCCSSSGC 230
>ACVR1_BOVIN (Q28041) Activin receptor type-1 precursor (EC 2.7.11.30) (Activin| receptor type I) (ACTR-I) (Serine/threonine-protein kinase receptor R1) (SKR1) Length = 509 Score = 28.5 bits (62), Expect = 4.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 318 CEARCCGEEAQCHGSRC 268 CE CG+EA C G +C Sbjct: 37 CEGLSCGDEAHCEGQQC 53
>KRA51_HUMAN (Q6L8H4) Keratin-associated protein 5-1 (Keratin-associated protein| 5.1) (Ultrahigh sulfur keratin-associated protein 5.1) Length = 278 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC PC C+ GS C++ CC + C S C Sbjct: 238 SCCKPCCCSSGC------GSSCCQSSCC--KPCCSQSSC 268
>CSMD1_MOUSE (Q923L3) CUB and sushi domain-containing protein 1 precursor (CUB and| sushi multiple domains protein 1) Length = 3564 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 9/50 (18%) Frame = -2 Query: 396 DFGLSCCHPCY---------CALQNHFRWQEGSGTCEARCCGEEAQCHGS 274 DF CHP Y C L + +Q TCEA+C E + S Sbjct: 2280 DFVKYQCHPGYTLLGSDTLTCKLSSQLLFQGSPPTCEAQCPANEVRTESS 2329
>ERBB2_CANFA (O18735) Receptor tyrosine-protein kinase erbB-2 precursor (EC| 2.7.10.1) (p185erbB2) (C-erbB-2) Length = 1259 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEAR----CCGEEAQCHG 277 S C PC A ++ W SG C++ C G A+C G Sbjct: 190 SACPPCSPACKDAHCWGASSGDCQSLTRTVCAGGCARCKG 229
>KRA58_HUMAN (O75690) Keratin-associated protein 5-8 (Keratin-associated protein| 5.8) (Ultrahigh sulfur keratin-associated protein 5.8) (Keratin, ultra high-sulfur matrix protein B) (UHS keratin B) (UHS KerB) Length = 187 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC PC C+ GS C++ CC + C S C Sbjct: 147 SCCKPCCCSSGC------GSSCCQSSCC--KPCCSQSSC 177 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC PC C+ GS C++ CC + C S C Sbjct: 118 SCCKPCSCSSGC------GSSCCQSSCC--KPCCSQSSC 148
>KRA55_HUMAN (Q701N2) Keratin-associated protein 5-5 (Keratin-associated protein| 5.5) (Ultrahigh sulfur keratin-associated protein 5.5) (Keratin-associated protein 5-11) (Keratin-associated protein 5.11) Length = 221 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC PC C+ GS C++ CC + C S C Sbjct: 152 SCCKPCCCSSGC------GSSCCQSSCC--KPYCCQSSC 182
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC PC C+ GS C++ CC + C S C Sbjct: 169 SCCKPCCCSSGC------GSSCCQSSCC--KPCCSQSSC 199 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCC 301 SCC PC C+ GS C++ CC Sbjct: 198 SCCKPCCCSSGC------GSSCCQSSCC 219
>LAMB1_MOUSE (P02469) Laminin beta-1 chain precursor (Laminin B1 chain)| Length = 1786 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -2 Query: 399 FDFGLSCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCH 280 F FG + C PC C LQ G+ A C QCH Sbjct: 811 FGFGPNGCKPCDCHLQ---------GSASAFCDAITGQCH 841
>SCRP_PANIM (P56972) Scorpin precursor (Scorpine)| Length = 94 Score = 27.7 bits (60), Expect = 6.8 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -2 Query: 324 GTCEARC--CGEEAQCHGSRC 268 G CE C GE+ CHG++C Sbjct: 66 GNCEKHCQTSGEKGYCHGTKC 86
>KRA13_HUMAN (Q8IUG1) Keratin-associated protein 1-3 (Keratin-associated protein| 1.8) (Keratin-associated protein 1.9) Length = 177 Score = 27.7 bits (60), Expect = 6.8 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC +C + SGTC + CC + + C S C Sbjct: 48 SCCQTSFCGFPSF----STSGTCSSSCC-QPSCCETSCC 81
>KRA57_HUMAN (Q6L8G8) Keratin-associated protein 5-7 (Keratin-associated protein| 5.7) (Ultrahigh sulfur keratin-associated protein 5.7) (Keratin-associated protein 5-3) (Keratin-associated protein 5.3) Length = 165 Score = 27.7 bits (60), Expect = 6.8 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -2 Query: 384 SCCHPCYCALQNHFRWQEGSGTCEARCCGEEAQCHGSRC 268 SCC PC C+ GS C++ CC C S C Sbjct: 125 SCCKPCCCSSGC------GSSCCQSSCC--NPCCSQSSC 155
>LAML1_CAEEL (Q18823) Laminin-like protein C54D1.5 precursor| Length = 1535 Score = 27.3 bits (59), Expect = 8.9 Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = -2 Query: 399 FDFGLSCCHPCYC----ALQNHFRWQEGSGTCEARCCGEEAQC 283 +DF + C C C +L N R SG+C + E QC Sbjct: 425 YDFSTNGCKNCGCETSGSLNNQPRCDSSSGSCSCKLNVEGRQC 467
>MEGF6_RAT (O88281) Multiple epidermal growth factor-like domains 6 precursor| (EGF-like domain-containing protein 3) (Multiple EGF-like domain protein 3) Length = 1574 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -2 Query: 393 FGLSCCHPCYCALQNHFRWQEGSGTCEA--RCCGEEAQCHGSRC 268 +G C HPC C+ G G C+A C EA G RC Sbjct: 869 WGPDCIHPCNCS--------AGHGNCDAVSGLCLCEAGYEGPRC 904
>RIN1_HUMAN (Q13671) Ras and Rab interactor 1 (Ras interaction/interference| protein 1) (Ras inhibitor JC99) Length = 783 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 336 QEGSGTCEARCCGEEAQCHG 277 +EGSG EAR GEE C G Sbjct: 716 EEGSGQSEARSRGEEQGCQG 735 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,823,276 Number of Sequences: 219361 Number of extensions: 630663 Number of successful extensions: 1883 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1780 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1878 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)