| Clone Name | rbags11n11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYI_DECAR (Q47BK5) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isole... | 31 | 3.8 | 2 | SYM_STAHJ (Q4L3E7) Methionyl-tRNA synthetase (EC 6.1.1.10) (Meth... | 30 | 6.5 |
|---|
>SYI_DECAR (Q47BK5) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 932 Score = 30.8 bits (68), Expect = 3.8 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 376 DNWG*KGSSFWWISRGSFAADHAKEVSGLVQGTTRRR 266 D W G++ W + RGS AADH ++G+ + R Sbjct: 540 DVWFDSGTTHWHVMRGSHAADHTYPADLYLEGSDQHR 576
>SYM_STAHJ (Q4L3E7) Methionyl-tRNA synthetase (EC 6.1.1.10) (Methionine--tRNA| ligase) (MetRS) Length = 659 Score = 30.0 bits (66), Expect = 6.5 Identities = 12/39 (30%), Positives = 25/39 (64%) Frame = +3 Query: 318 AAKEPLLIHQKLLPFYPQLSAKAQIGRWKRATKIYKNQE 434 A K+P+++ +K P +P+L +A+I K + + K++E Sbjct: 504 ALKQPIMVTEKPTPIFPRLDTEAEIAYIKESMQPPKSEE 542 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,733,051 Number of Sequences: 219361 Number of extensions: 1966895 Number of successful extensions: 4163 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4163 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)