| Clone Name | rbags11n07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YUAG_BACSU (O32076) Hypothetical protein yuaG | 35 | 0.19 | 2 | MYO3B_HUMAN (Q8WXR4) Myosin IIIB (EC 2.7.11.1) | 33 | 0.72 | 3 | NPHP1_CANFA (Q9TU19) Nephrocystin-1 (Fragment) | 29 | 7.9 |
|---|
>YUAG_BACSU (O32076) Hypothetical protein yuaG| Length = 509 Score = 34.7 bits (78), Expect = 0.19 Identities = 17/59 (28%), Positives = 33/59 (55%), Gaps = 8/59 (13%) Frame = -2 Query: 422 TTPKSFQDQGIPTPTDG------GGTVGSVVQVAQEMFGTREEGQKPE*RQ--KGRKRS 270 +TP+ + +QG+P DG GG++G + A++ G ++ ++ E R+ +G RS Sbjct: 87 STPEVYTEQGVPVMADGTAIIKIGGSIGEIATAAEQFLGKSKDDREQEAREVLEGHLRS 145
>MYO3B_HUMAN (Q8WXR4) Myosin IIIB (EC 2.7.11.1)| Length = 1341 Score = 32.7 bits (73), Expect = 0.72 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 65 TR*CSEIQDITQDGPHTITKTECHRWSHRLAHTNSQR 175 TR +E+QD ++ G H + + HR SH A +N+ R Sbjct: 1141 TRGSAEVQDCSEPGDHKVLRGSVHRRSHSQAESNNGR 1177
>NPHP1_CANFA (Q9TU19) Nephrocystin-1 (Fragment)| Length = 565 Score = 29.3 bits (64), Expect = 7.9 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = -2 Query: 248 ILIKLKSYYSPGRDYALLSIISETVAGSLCVL 153 +L+KL+S RD LLS++ ET+ GS+C + Sbjct: 382 LLVKLRSLNRRSRD--LLSLLPETLIGSMCTI 411 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,773,810 Number of Sequences: 219361 Number of extensions: 1523871 Number of successful extensions: 4165 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4162 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)