| Clone Name | rbags11k12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ADP2_MYCGA (Q9REM8) Adhesin P1 precursor (Cytadhesin P1) (Attach... | 30 | 6.6 | 2 | ADP1_MYCGA (Q49379) Adhesin P1 precursor (Cytadhesin P1) (Attach... | 30 | 6.6 | 3 | CU55_ARADI (P80518) Adult-specific rigid cuticular protein 15.5 ... | 30 | 8.7 |
|---|
>ADP2_MYCGA (Q9REM8) Adhesin P1 precursor (Cytadhesin P1) (Attachment protein)| (Adherence protein A) Length = 1122 Score = 30.0 bits (66), Expect = 6.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 506 GANGGKNEHTKWHSFGVHTDSPTS 435 G NGG TKWHS V D+PT+ Sbjct: 510 GTNGGNFLDTKWHSPAVIEDAPTT 533
>ADP1_MYCGA (Q49379) Adhesin P1 precursor (Cytadhesin P1) (Attachment protein)| Length = 1122 Score = 30.0 bits (66), Expect = 6.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 506 GANGGKNEHTKWHSFGVHTDSPTS 435 G NGG TKWHS V D+PT+ Sbjct: 510 GTNGGNFLDTKWHSPAVIEDAPTT 533
>CU55_ARADI (P80518) Adult-specific rigid cuticular protein 15.5 (ACP 15.5)| Length = 156 Score = 29.6 bits (65), Expect = 8.7 Identities = 21/63 (33%), Positives = 25/63 (39%) Frame = +1 Query: 436 EVGLSVCTPKECHFVCSFLPPFAPVACFQKAKLLLLEGPSVALPTLCQEVYPLFVGPSIQ 615 E G ++ P V + PP APVA P+VA P L PL P I Sbjct: 80 EPGTALSAPASAAIVSPYAPPVAPVA------------PAVAAPALA--AAPLLAAPGIA 125 Query: 616 SIS 624 S S Sbjct: 126 SYS 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,537,147 Number of Sequences: 219361 Number of extensions: 1174725 Number of successful extensions: 3925 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3808 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3923 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)