| Clone Name | rbags11f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y2227_MYCTU (Q10511) Hypothetical protein Rv2227/MT2286 | 30 | 4.4 | 2 | PDE3B_MOUSE (Q61409) cGMP-inhibited 3',5'-cyclic phosphodiestera... | 29 | 7.6 | 3 | ZN142_HUMAN (P52746) Zinc finger protein 142 (HA4654) | 29 | 7.6 | 4 | RECA_LACJO (P62216) Protein recA (Recombinase A) | 29 | 9.9 | 5 | HEMH_CAUCR (P57777) Ferrochelatase (EC 4.99.1.1) (Protoheme ferr... | 29 | 9.9 | 6 | RECA_LACAC (Q5FL82) Protein recA (Recombinase A) | 29 | 9.9 |
|---|
>Y2227_MYCTU (Q10511) Hypothetical protein Rv2227/MT2286| Length = 233 Score = 30.0 bits (66), Expect = 4.4 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = -2 Query: 542 PDPSGDWTVLSHASGSVWKRGDTAAQVMGSSNRWNALESD 423 PD DW HA+G TA + +N WNAL D Sbjct: 103 PDSLDDWLASCHAAGQT---RSTALMLKYGTNDWNALHQD 139
>PDE3B_MOUSE (Q61409) cGMP-inhibited 3',5'-cyclic phosphodiesterase B (EC| 3.1.4.17) (Cyclic GMP-inhibited phosphodiesterase B) (CGI-PDE B) (CGIPDE1) (Fragment) Length = 799 Score = 29.3 bits (64), Expect = 7.6 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = +2 Query: 242 GLIIHMILPSPQLRRQAAACSLIAQHLVLRWIQRQGQNCW 361 GL P+PQLRR + A SL+ RW + G+ + Sbjct: 119 GLSGRTSFPTPQLRRSSGASSLLTNEHCSRWDRSSGKRSY 158
>ZN142_HUMAN (P52746) Zinc finger protein 142 (HA4654)| Length = 1687 Score = 29.3 bits (64), Expect = 7.6 Identities = 27/96 (28%), Positives = 38/96 (39%), Gaps = 3/96 (3%) Frame = +2 Query: 245 LIIHMILPSPQLRRQAAACSLI---AQHLVLRWIQRQGQNCWILFQCEE*AYVCRLAQSW 415 L +HM + LR Q CS A L ++ QG++ CE A+ C+ Sbjct: 472 LRVHMRKHAGDLRYQCNQCSYRCHRADQLSSHKLRHQGKS----LMCEVCAFACKRKYEL 527 Query: 416 LQHQTPGHSSGLKNP*PEQPYHHVSTPTLKHD*VLS 523 +H H G P P P H+ S + VLS Sbjct: 528 QKHMASQHHPG--TPSPLYPCHYCSYQSRHKQAVLS 561
>RECA_LACJO (P62216) Protein recA (Recombinase A)| Length = 360 Score = 28.9 bits (63), Expect = 9.9 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 542 PDPSGDWTVLSHASGSVWKRGDTAAQV 462 P+ SG TV HA V KRG TAA + Sbjct: 67 PESSGKTTVALHAVAEVQKRGGTAAYI 93
>HEMH_CAUCR (P57777) Ferrochelatase (EC 4.99.1.1) (Protoheme ferro-lyase) (Heme| synthetase) Length = 347 Score = 28.9 bits (63), Expect = 9.9 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -3 Query: 406 GQPTNVSLLFALKQDPAVLPLALDPAQHQV 317 G PTN+ LLF+ P + LA DP Q QV Sbjct: 181 GSPTNIRLLFSAHGLPEKVILAGDPYQKQV 210
>RECA_LACAC (Q5FL82) Protein recA (Recombinase A)| Length = 363 Score = 28.9 bits (63), Expect = 9.9 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 542 PDPSGDWTVLSHASGSVWKRGDTAAQV 462 P+ SG TV HA V KRG TAA + Sbjct: 67 PESSGKTTVALHAVAEVQKRGGTAAYI 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 80,061,318 Number of Sequences: 219361 Number of extensions: 1600702 Number of successful extensions: 3703 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3702 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4373119116 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)