| Clone Name | rbags10p24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | I28RA_HUMAN (Q8IU57) Interleukin-28 receptor alpha chain precurs... | 30 | 6.1 | 2 | VASS_BPGA (P07394) Assembly protein (Maturation protein) (A prot... | 30 | 8.0 | 3 | GALK1_ARATH (Q9SEE5) Galactokinase (EC 2.7.1.6) (Galactose kinase) | 30 | 8.0 |
|---|
>I28RA_HUMAN (Q8IU57) Interleukin-28 receptor alpha chain precursor| (IL-28R-alpha) (IL-28RA) (Cytokine receptor family 2 member 12) (Cytokine receptor class-II member 12) (CRF2-12) (Interferon lambda receptor 1) (IFN-lambda R1) (Likely interleukin or cyto Length = 520 Score = 30.0 bits (66), Expect = 6.1 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = +2 Query: 8 CKSARVMLTFIVYHYRTTTTPLCLIYWWNEVPRCS----V*PAYIDVLVLTNVGSLVMPT 175 C SAR + TF V Y + P C + EVP + V P+ + +L++ G ++ T Sbjct: 195 CLSARTIYTFSVPKYSKFSKPTCFLL---EVPEANWAFLVLPSLLILLLVIAAGGVIWKT 251 Query: 176 AIGS 187 +G+ Sbjct: 252 LMGN 255
>VASS_BPGA (P07394) Assembly protein (Maturation protein) (A protein)| Length = 390 Score = 29.6 bits (65), Expect = 8.0 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 8/72 (11%) Frame = -2 Query: 250 RVTYRLSSRVRLPVLANLGT*RSDGGRHN-KTSNICQDKNIDISWSYR-------TTWHF 95 + Y L ++ +LP L R+ GG HN K N+ ++ +WSYR W+F Sbjct: 210 KAAYDLLTQTKLPAFMPLRVTRTVGGTHNYKVRNV---ESAGDTWSYRHRLSVNYRIWYF 266 Query: 94 IPPVDQA*WCSS 59 I A W SS Sbjct: 267 ISDPRLA-WASS 277
>GALK1_ARATH (Q9SEE5) Galactokinase (EC 2.7.1.6) (Galactose kinase)| Length = 496 Score = 29.6 bits (65), Expect = 8.0 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 638 AVTVVDPKRSYSVKAPTRHPIYENFRVEAFKALLTAAKTDEQ-LSALGELMYQCHYS 471 ++ V++ + + H E RV FK + + +DE+ L LG+LM + HYS Sbjct: 349 SLAVLNAATHFKLHQRAAHVYSEARRVHGFKDTVNSNLSDEEKLKKLGDLMNESHYS 405 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,983,226 Number of Sequences: 219361 Number of extensions: 2014615 Number of successful extensions: 4786 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4605 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4786 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)