ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags10p11 |
|---|---|
| Clone Library Name | barley_pub |
>UCRI5_TOBAC (P51135) Ubiquinol-cytochrome c reductase iron-sulfur subunit 5,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 5) (RISP5) Length = 268 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAPYNLEVPTYS ++ K+LIG Sbjct: 238 DISGRIRKGPAPYNLEVPTYSFMEENKLLIG 268
>UCRI3_TOBAC (P51133) Ubiquinol-cytochrome c reductase iron-sulfur subunit 3,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 3) (RISP3) Length = 268 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAPYNLEVPTYS ++ K+LIG Sbjct: 238 DISGRIRKGPAPYNLEVPTYSFMEENKLLIG 268
>UCRI_SOLTU (P37841) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 265 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAPYNLEVPTYS ++ K+LIG Sbjct: 235 DISGRIRKGPAPYNLEVPTYSFLEENKLLIG 265
>UCRI4_TOBAC (P51134) Ubiquinol-cytochrome c reductase iron-sulfur subunit 4,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 4) (RISP4) Length = 236 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAPYNLEVPTYS ++ K+LIG Sbjct: 206 DISGRIRKGPAPYNLEVPTYSFLEENKLLIG 236
>UCRI1_TOBAC (P49729) Ubiquinol-cytochrome c reductase iron-sulfur subunit 1,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 1) (RISP1) (Fragment) Length = 258 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAPYNLEVPTYS ++ K+LIG Sbjct: 228 DISGRIRKGPAPYNLEVPTYSFLEENKLLIG 258
>UCRI2_TOBAC (P51132) Ubiquinol-cytochrome c reductase iron-sulfur subunit 2,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 2) (RISP2) Length = 272 Score = 55.8 bits (133), Expect = 3e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAPYNLEVPTYS ++ K+LIG Sbjct: 242 DISGRIRKGPAPYNLEVPTYSFLEENKLLIG 272
>UCRI_MAIZE (P49727) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 273 Score = 53.9 bits (128), Expect = 1e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAP+NLEVPTYS ++ K+L+G Sbjct: 243 DISGRIRKGPAPFNLEVPTYSFLEENKLLVG 273
>UCRI_NEUCR (P07056) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 231 Score = 47.0 bits (110), Expect = 2e-05 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAP NLE+P Y ++ K++IG Sbjct: 201 DISGRIRKGPAPLNLEIPLYEFPEEGKLVIG 231
>UCRI_AOTAZ (Q69BJ9) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 46.6 bits (109), Expect = 2e-05 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIRKGPAP NLEVPTY D +++G Sbjct: 244 DASGRIRKGPAPLNLEVPTYEFTSDDLVIVG 274
>UCRI_SAISC (Q69BJ7) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 46.2 bits (108), Expect = 3e-05 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIRKGPAP NLEVPTY D +++G Sbjct: 244 DASGRIRKGPAPLNLEVPTYEFLSDDMVVVG 274
>UCRI_LAGLA (Q69BJ8) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 46.2 bits (108), Expect = 3e-05 Identities = 20/31 (64%), Positives = 23/31 (74%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIRKGPAP NLEVPTY D +++G Sbjct: 244 DASGRIRKGPAPLNLEVPTYEFTGDDMVIVG 274
>UCRI_BOVIN (P13272) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) [Contains: Ubiquinol-cytochrome c reductase 8 kDa protein (Complex III subunit IX)] Length = 274 Score = 45.4 bits (106), Expect = 4e-05 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIRKGPAP NLEVP+Y D +++G Sbjct: 244 DASGRIRKGPAPLNLEVPSYEFTSDDMVIVG 274
>UCRI_PANTR (Q69BK5) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 44.3 bits (103), Expect = 1e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR GPAP NLEVPTY D +++G Sbjct: 244 DASGRIRLGPAPLNLEVPTYEFTSDDMVIVG 274
>UCRI_PANPA (Q69BK6) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 44.3 bits (103), Expect = 1e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR GPAP NLEVPTY D +++G Sbjct: 244 DASGRIRLGPAPLNLEVPTYEFTSDDMVIVG 274
>UCRI_MOUSE (Q9CR68) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 44.3 bits (103), Expect = 1e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIRKGPAP NLEVP Y D +++G Sbjct: 244 DASGRIRKGPAPLNLEVPAYEFTSDDVVVVG 274
>UCRI_HYLSY (Q69BJ6) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 44.3 bits (103), Expect = 1e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR GPAP NLEVPTY D +++G Sbjct: 244 DASGRIRLGPAPLNLEVPTYEFTSDDMVIVG 274
>UCRI_HUMAN (P47985) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 44.3 bits (103), Expect = 1e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR GPAP NLEVPTY D +++G Sbjct: 244 DASGRIRLGPAPLNLEVPTYEFTSDDMVIVG 274
>UCRI_GORGO (Q69BK4) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 44.3 bits (103), Expect = 1e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR GPAP NLEVPTY D +++G Sbjct: 244 DASGRIRLGPAPLNLEVPTYEFTSDDMVIVG 274
>UCRI_COLPO (Q69BK0) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 43.9 bits (102), Expect = 1e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR GPAP NLEVPTY D +++G Sbjct: 244 DASGRIRLGPAPLNLEVPTYEFTSDDMVVVG 274
>UCRI_YEAST (P08067) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 215 Score = 43.5 bits (101), Expect = 2e-04 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIRKGPAP NLE+P Y D K+++G Sbjct: 186 DISGRIRKGPAPLNLEIPAYEFDGD-KVIVG 215
>UCRI_RAT (P20788) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) (Liver regeneration-related protein LRRGT00195) Length = 274 Score = 43.5 bits (101), Expect = 2e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIRKGPAP NLEVPTY +++G Sbjct: 244 DASGRIRKGPAPLNLEVPTYEFTSGDVVVVG 274
>UCRI_THEGE (Q69BK2) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D+SGRIR GPAP NLEVP Y D +++G Sbjct: 244 DVSGRIRLGPAPLNLEVPPYEFTSDDMVVVG 274
>UCRI_RHORU (P23136) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 182 Score = 42.4 bits (98), Expect = 4e-04 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D +GRIRKGPAP NL VP Y+ D +LIG Sbjct: 152 DSAGRIRKGPAPLNLPVPPYAFTDDTTVLIG 182
>UCRI_PONPY (Q69BK3) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 42.0 bits (97), Expect = 5e-04 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR GPAP NLEVP Y D +++G Sbjct: 244 DASGRIRLGPAPLNLEVPIYEFTSDDMVIVG 274
>UCRI_RICPR (Q9ZDQ5) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 177 Score = 41.6 bits (96), Expect = 6e-04 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGR+RKGPAP NL VP Y D K+ IG Sbjct: 147 DSSGRVRKGPAPLNLAVPPYIFISDKKIRIG 177
>UCRI_BRAJA (P51130) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 176 Score = 41.2 bits (95), Expect = 8e-04 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR+GPAP NL VP Y D K+ IG Sbjct: 146 DSSGRIRQGPAPANLPVPPYQFVSDTKIQIG 176
>UCRI_RHOVI (P81380) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 179 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGR+RKGPAP NL VP Y + K+ IG Sbjct: 145 DASGRVRKGPAPTNLPVPPYEFVDNTKIRIG 175
>UCRI_CERAE (Q69BK1) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 274 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR GPAP NLEVP Y D +++G Sbjct: 244 DASGRIRLGPAPLNLEVPPYEFTGDDVVVVG 274
>UCRI_SCHPO (Q09154) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 228 Score = 39.7 bits (91), Expect = 0.002 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 DISGRIR+GPAP NL +P Y+ + K++IG Sbjct: 199 DISGRIRRGPAPLNLAIPAYT-FEGSKIIIG 228
>UCRI_PARDE (P05417) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 190 Score = 35.8 bits (81), Expect = 0.035 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D SGRIR+GPAP NL +P D + +G Sbjct: 160 DTSGRIRRGPAPQNLHIPVAEFLDDTTIKLG 190
>UCRI_RHOCA (P08500) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 191 Score = 34.7 bits (78), Expect = 0.077 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D +GRIRKGPAP NL++P + + + +G Sbjct: 161 DSAGRIRKGPAPRNLDIPVAAFVDETTIKLG 191
>UCRI_RHOSH (Q02762) Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC| 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 187 Score = 32.7 bits (73), Expect = 0.29 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 109 DISGRIRKGPAPYNLEVPTYSXXKDXKMLIG 17 D +GRIRKGPAP NL +P + + +G Sbjct: 157 DSAGRIRKGPAPENLPIPLAKFIDETTIQLG 187
>IBP2_CHICK (P49705) Insulin-like growth factor-binding protein 2 precursor| (IGFBP-2) (IBP-2) (IGF-binding protein 2) Length = 311 Score = 28.1 bits (61), Expect = 7.2 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 105 SLAESARALPRTTLRCPPTVXXKIXRCS 22 +LA + ALP RCPP ++ CS Sbjct: 27 ALALAGPALPEVLFRCPPCTAERLAACS 54 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,148,619 Number of Sequences: 219361 Number of extensions: 120859 Number of successful extensions: 337 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 80,573,946 effective HSP length: 11 effective length of database: 78,160,975 effective search space used: 1875863400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
