| Clone Name | rbags11d13 |
|---|---|
| Clone Library Name | barley_pub |
>COX12_SCHPO (O94581) Cytochrome c oxidase polypeptide VIb (EC 1.9.3.1)| Length = 83 Score = 38.1 bits (87), Expect = 0.016 Identities = 23/51 (45%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = -1 Query: 462 TYIAYD*AVTEKGTPFYNTA-FLSLITWLCFMQ-VERWNEQWENGTFPGPL 316 +YI Y + KG F F LC M+ VERW+EQ ENGTFP P+ Sbjct: 33 SYIDYFRCIKAKGEDFVPCKQFWHAYQSLCPMEWVERWDEQRENGTFPAPI 83
>CX6B2_MOUSE (Q80ZN9) Cytochrome c oxidase subunit VIb isoform 2 (EC 1.9.3.1)| (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform) Length = 88 Score = 32.0 bits (71), Expect = 1.1 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -1 Query: 417 FYNTAFLSL--ITWLCFMQVERWNEQWENGTFPGPL 316 +Y F SL I+W V+RWNEQ + GTFPG + Sbjct: 58 YYFRVFHSLCPISW-----VQRWNEQIKQGTFPGKI 88
>CX6B2_RAT (Q6YFQ1) Cytochrome c oxidase subunit VIb isoform 2 (EC 1.9.3.1)| (COX VIb-2) (Cytochrome c oxidase subunit VIb, testis-specific isoform) Length = 88 Score = 31.6 bits (70), Expect = 1.5 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -1 Query: 417 FYNTAFLSL--ITWLCFMQVERWNEQWENGTFPGPL 316 +Y F SL ++W V+RWNEQ + GTFPG + Sbjct: 58 YYFRVFHSLCPVSW-----VQRWNEQIKQGTFPGKI 88
>AATM_YEAST (Q01802) Aspartate aminotransferase, mitochondrial precursor (EC| 2.6.1.1) (Transaminase A) Length = 451 Score = 31.2 bits (69), Expect = 1.9 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 7/98 (7%) Frame = +1 Query: 121 NPVNDRWEKLMGSTFSLHQVKNLFVSSPQKGKGSGEFSAQS-------NFVQSPGR*VGM 279 +P ++WEK++ + + L V V +G SG + N + P G+ Sbjct: 221 DPTKEQWEKIIDTIYELKMVP--IVDMAYQGLESGNLLKDAYLLRLCLNVNKYPNWSNGI 278 Query: 280 MVCLSFQRH*SLQGSRECAILPLLVPTLNLHKTQPCYQ 393 +C SF ++ L G R ++ + T N K P Q Sbjct: 279 FLCQSFAKNMGLYGERVGSLSVITPATANNGKFNPLQQ 316
>ACER_DROME (Q9VLJ6) Angiotensin-converting enzyme-related protein precursor| (EC 3.4.15.1) Length = 630 Score = 29.3 bits (64), Expect = 7.3 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -2 Query: 341 RMAHSLDPCKLQWRWKDKH 285 R++HS DP +L W W++ H Sbjct: 161 RLSHSRDPAELAWYWREWH 179
>SUZ2_DROME (P25172) Protein suppressor 2 of zeste (Protein posterior sex combs)| Length = 1368 Score = 29.3 bits (64), Expect = 7.3 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 8/55 (14%) Frame = +3 Query: 78 KQQVQSNSKGGRCTKSSE*SLGETDGQHLQ--------LTSSQKLICK*SSKRKG 218 KQ + +NS GG T S S G T+G LQ T+ +K+ K +S G Sbjct: 1113 KQNISANSNGGPSTTSGSNSNGTTNGDDLQNLHMLSESATAREKISIKAASSGNG 1167
>SMAL1_MOUSE (Q8BJL0) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A-like protein 1 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 1) (HepA-related protein) (mharp) Length = 910 Score = 28.9 bits (63), Expect = 9.5 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -3 Query: 307 SGAGRTNIPSSPPTSLVTGQSYFVPRIR 224 S G+T++PS+P + VTG+ + R+R Sbjct: 274 SVGGQTSLPSAPSLTFVTGKCMLISRVR 301
>RS2_BACSU (P21464) 30S ribosomal protein S2 (BS1) (Vegetative protein 209)| (VEG209) Length = 245 Score = 28.9 bits (63), Expect = 9.5 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +1 Query: 58 DLNRVTQNSKFSQIPKVDVVQ-NPVNDRWEKLMGSTFSLHQVKN-LFVSSPQK 210 D+ ++ +N F +PK +VVQ +R EK +G + + + LF+ P+K Sbjct: 115 DIEKMQENGTFDVLPKKEVVQLKKELERLEKFLGGIKDMKDLPDALFIIDPRK 167 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,962,839 Number of Sequences: 219361 Number of extensions: 1628740 Number of successful extensions: 3489 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3489 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)