| Clone Name | rbags10n17 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 35.0 bits (79), Expect = 0.19 Identities = 38/126 (30%), Positives = 46/126 (36%), Gaps = 4/126 (3%) Frame = -1 Query: 548 GPGHMQLPDWSTRPSAPTGSGRRQ*TAMCSCSTGAPGQALLLRLAEDNELP-RAAA*LEH 372 GP L DW +R G Q A C C G G RL + LP R AA Sbjct: 994 GPQCQTLVDWCSRQPCQNGGRCVQTGAYCLCPPGWSG-----RLCDIRSLPCREAAAQIG 1048 Query: 371 QALRSYCVWVKPHWCEATGLELEQMKPHWCEGACLEPEQRQAA---STAAPCHCHPCSQG 201 L C+A G +++ H+C C PE R + PC PC G Sbjct: 1049 VRLEQL--------CQAGGQCVDEDSSHYC--VC--PEGRTGSHCEQEVDPCLAQPCQHG 1096 Query: 200 PPGNCR 183 G CR Sbjct: 1097 --GTCR 1100
>MEGF8_MOUSE (P60882) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2330 Score = 31.6 bits (70), Expect = 2.0 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 287 WCEGACLEPEQRQAASTAAPCHCHPCSQGP--PGNCRR 180 WC GACL +Q P PCS P P CRR Sbjct: 1379 WCHGACLSGDQAHRLGCGVP----PCSPMPRSPEECRR 1412
>METE_PASMU (P57843) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 757 Score = 30.4 bits (67), Expect = 4.6 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 591 KRVAWGHPACGLTARTWPHAAARLE 517 K W +P CGL R WP A+LE Sbjct: 719 KERLWVNPDCGLKTRGWPETIAQLE 743
>MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2386 Score = 30.4 bits (67), Expect = 4.6 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = -1 Query: 287 WCEGACLEPEQRQAASTAAPCHCHPCSQGP--PGNCRR 180 WC GACL +Q C PCS P P CRR Sbjct: 1435 WCHGACLSGDQAHRLG----CGGSPCSPMPRSPEECRR 1468
>METE_SALTY (Q9L6N1) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 753 Score = 30.0 bits (66), Expect = 6.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 579 WGHPACGLTARTWPHAAARLEHQAKRSY 496 W +P CGL R WP A L + K ++ Sbjct: 720 WVNPDCGLKTRGWPETRAALANMVKAAH 747
>METE_SALTI (Q8Z3B6) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 753 Score = 30.0 bits (66), Expect = 6.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 579 WGHPACGLTARTWPHAAARLEHQAKRSY 496 W +P CGL R WP A L + K ++ Sbjct: 720 WVNPDCGLKTRGWPETRAALANMVKAAH 747
>METE_STRCO (Q93J59) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 772 Score = 29.6 bits (65), Expect = 7.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 579 WGHPACGLTARTWPHAAARLEH 514 W +P CGL R WP A LE+ Sbjct: 736 WVNPDCGLKTRGWPETRASLEN 757
>METE_STRAW (Q82LG4) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 772 Score = 29.6 bits (65), Expect = 7.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -3 Query: 579 WGHPACGLTARTWPHAAARLEH 514 W +P CGL R WP A LE+ Sbjct: 736 WVNPDCGLKTRGWPETRASLEN 757 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,288,650 Number of Sequences: 219361 Number of extensions: 1938019 Number of successful extensions: 5636 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5179 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5631 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)