ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbags10n11 |
|---|---|
| Clone Library Name | barley_pub |
>RTEL1_HUMAN (Q9NZ71) Regulator of telomere elongation helicase 1 (EC 3.6.1.-)| (Helicase-like protein NHL) Length = 1400 Score = 46.2 bits (108), Expect = 2e-05 Identities = 25/70 (35%), Positives = 36/70 (51%) Frame = -2 Query: 212 R*TNLLAGRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLTCGQNYGEV 33 R N GR IRH DY A+ L D R+A F+ +LP W++ + N+G V Sbjct: 689 RAVNQAIGRVIRHRQDYGAVFLCDHRFA-------FADARAQLPSWVRPHVRVYDNFGHV 741 Query: 32 HRLLHQFFKI 3 R + QFF++ Sbjct: 742 IRDVAQFFRV 751
>DDX11_MOUSE (Q6AXC6) Probable ATP-dependent RNA helicase DDX11 (EC 3.6.1.-)| (DEAD/H box protein 11) Length = 880 Score = 43.5 bits (101), Expect = 1e-04 Identities = 23/66 (34%), Positives = 35/66 (53%) Frame = -2 Query: 203 NLLAGRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLTCGQNYGEVHRL 24 N GRAIRH D+A+++L+D RYA S + KLP WI+ R+ +G Sbjct: 814 NQSIGRAIRHQRDFASIVLLDHRYARPSI-------LAKLPAWIRDRVEVKATFGPAFAA 866 Query: 23 LHQFFK 6 + +F + Sbjct: 867 VRKFHR 872
>FANCJ_CHICK (Q3YK19) Fanconi anemia group J protein homolog (EC 3.6.1.-)| (ATP-dependent RNA helicase BRIP1) (Protein FACJ) Length = 1252 Score = 40.4 bits (93), Expect = 0.001 Identities = 20/64 (31%), Positives = 34/64 (53%) Frame = -2 Query: 203 NLLAGRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLTCGQNYGEVHRL 24 N GR IRH +D+ A++LVD R+ + + + L +WI+ ++ +N+G Sbjct: 836 NQALGRCIRHRSDWGALILVDDRFRNNPNKY-----ITGLSKWIRQQVQHHENFGSALES 890 Query: 23 LHQF 12 LH F Sbjct: 891 LHAF 894
>CHL1_YEAST (P22516) Probable ATP-dependent RNA helicase CHL1 (EC 3.6.1.-)| Length = 861 Score = 37.0 bits (84), Expect = 0.013 Identities = 21/67 (31%), Positives = 32/67 (47%) Frame = -2 Query: 203 NLLAGRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLTCGQNYGEVHRL 24 N GRAIRH NDYA + L+D RY + + KL +W++ + +V Sbjct: 796 NQSVGRAIRHANDYANIYLLDVRYNRPNFRK-------KLSRWVQDSINSEHTTHQVISS 848 Query: 23 LHQFFKI 3 +FF + Sbjct: 849 TRKFFSM 855
>FANCJ_HUMAN (Q9BX63) Fanconi anemia group J protein (EC 3.6.1.-) (ATP-dependent| RNA helicase BRIP1) (Protein FACJ) (BRCA1-interacting protein C-terminal helicase 1) (BRCA1-interacting protein 1) (BRCA1-associated C-terminal helicase 1) Length = 1249 Score = 35.8 bits (81), Expect = 0.030 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = -2 Query: 203 NLLAGRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLTCGQNYGEVHRL 24 N GR IRH ND+ A++LVD R+ + S + L +W++ ++ + Sbjct: 826 NQALGRCIRHRNDWGALILVDDRFRNNPSRY-----ISGLSKWVRQQIQHHSTFESALES 880 Query: 23 LHQFFK 6 L +F K Sbjct: 881 LAEFSK 886
>ERCC2_MOUSE (O08811) TFIIH basal transcription factor complex helicase subunit| (EC 3.6.1.-) (DNA-repair protein complementing XP-D cells) (Xeroderma pigmentosum group D complementing protein) (CXPD) (DNA excision repair protein ERCC-2) Length = 760 Score = 35.4 bits (80), Expect = 0.039 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = -2 Query: 191 GRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLT 57 GRAIR DY M+ D R+A + RG KLP+WI+ LT Sbjct: 665 GRAIRGKTDYGLMVFADKRFAR-ADKRG------KLPRWIQEHLT 702
>ERCC2_CRIGR (Q60452) TFIIH basal transcription factor complex helicase subunit| (EC 3.6.1.-) (DNA-repair protein complementing XP-D cells) (Xeroderma pigmentosum group D complementing protein) (CXPD) (DNA excision repair protein ERCC-2) Length = 760 Score = 35.4 bits (80), Expect = 0.039 Identities = 20/45 (44%), Positives = 25/45 (55%) Frame = -2 Query: 191 GRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLT 57 GRAIR DY M+ D R+A + RG KLP+WI+ LT Sbjct: 665 GRAIRGKTDYGLMVFADKRFAR-ADKRG------KLPRWIQEHLT 702
>ERCC2_HUMAN (P18074) TFIIH basal transcription factor complex helicase subunit| (EC 3.6.1.-) (DNA-repair protein complementing XP-D cells) (Xeroderma pigmentosum group D complementing protein) (CXPD) (DNA excision repair protein ERCC-2) Length = 760 Score = 35.0 bits (79), Expect = 0.051 Identities = 20/45 (44%), Positives = 24/45 (53%) Frame = -2 Query: 191 GRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLT 57 GRAIR DY M+ D R+A RG KLP+WI+ LT Sbjct: 665 GRAIRGKTDYGLMVFADKRFAR-GDKRG------KLPRWIQEHLT 702
>LIPA_LEIXX (Q6AFG7) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 329 Score = 35.0 bits (79), Expect = 0.051 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEVHRLL 21 R P+E+ P+WIK R T G Y ++H L+ Sbjct: 16 RNAQTPIERKPEWIKTRATMGPEYRQLHSLV 46
>FANCJ_MOUSE (Q5SXJ3) Fanconi anemia group J protein homolog (EC 3.6.1.-)| (ATP-dependent RNA helicase BRIP1) (Protein FACJ) (BRCA1-interacting protein C-terminal helicase 1) (BRCA1-interacting protein 1) (BRCA1-associated C-terminal helicase 1) Length = 1174 Score = 34.7 bits (78), Expect = 0.067 Identities = 17/64 (26%), Positives = 32/64 (50%) Frame = -2 Query: 203 NLLAGRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARLTCGQNYGEVHRL 24 N GR IRH ND+ A++LVD R+ + + + L +W++ ++ ++ Sbjct: 829 NQALGRCIRHKNDWGALILVDDRFNNNPNRY-----ISGLSKWVRQQIQHHSSFASALES 883 Query: 23 LHQF 12 L +F Sbjct: 884 LTEF 887
>LIPA_TROWT (Q83MU9) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 351 Score = 30.8 bits (68), Expect = 0.97 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEV 33 R P+E+ P WI+AR T G Y +V Sbjct: 35 RNSQVPIERKPSWIRARATIGTEYRKV 61
>LIPA_TROW8 (Q83NN8) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 351 Score = 30.8 bits (68), Expect = 0.97 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEV 33 R P+E+ P WI+AR T G Y +V Sbjct: 35 RNSQVPIERKPSWIRARATIGTEYRKV 61
>LIPA_MYCTU (P65283) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 311 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEVHRLLHQ 15 R P+E+ P WIK R G Y E+ L+ + Sbjct: 16 RNAQTPIERKPPWIKTRARIGPEYTELKNLVRR 48
>LIPA_MYCBO (P65284) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 311 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEVHRLLHQ 15 R P+E+ P WIK R G Y E+ L+ + Sbjct: 16 RNAQTPIERKPPWIKTRARIGPEYTELKNLVRR 48
>LIPA_STRCO (Q9S2P2) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 317 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEVHRLL 21 R P+E+ P+WIK R G Y ++ L+ Sbjct: 17 RNSQTPIERKPEWIKTRAKMGPEYTKMQNLV 47
>LIPA_STRAW (Q82AP7) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 328 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEVHRLL 21 R P+E+ P+WIK R G Y ++ L+ Sbjct: 17 RNAQTPIERKPEWIKTRAKMGPEYTKMQNLV 47
>ERCC2_ARATH (Q8W4M7) DNA repair helicase UVH6 (EC 3.6.1.-) (UV hypersensitive| protein 6) (XPD homolog) (ERCC2 homolog) (RAD3 homolog) (AtUVH6) (AtXPD) Length = 758 Score = 29.3 bits (64), Expect = 2.8 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -2 Query: 191 GRAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQWIKARL 60 GR IR DY M+ D RY+ KLP WI + L Sbjct: 665 GRVIRSKADYGMMIFADKRYSRHDKR-------SKLPGWILSHL 701
>LIPA_MYCPA (P61197) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 307 Score = 28.5 bits (62), Expect = 4.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEVHRLLHQ 15 R P+E+ P WI+ R G Y E+ L+ + Sbjct: 16 RNAETPIERKPPWIRVRARMGPEYTELKSLVRR 48
>POL5_DROME (Q8I7P9) Retrovirus-related Pol polyprotein from transposon opus| [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); Endonuclease] Length = 1003 Score = 28.1 bits (61), Expect = 6.3 Identities = 13/51 (25%), Positives = 21/51 (41%) Frame = -3 Query: 157 QCCWLTHVTHTPHQAGVSPALLKSYPSGSRHDSLAVKTMGKFIDCCISFSK 5 QCC L P++ + P + +YP H + ++ C FSK Sbjct: 736 QCCKLYKYERHPNKPNLQPTPIPNYPCEILHIDIFALEKRLYLSCIDKFSK 786
>GLNE_AZOSE (Q5P7S1) Glutamate-ammonia-ligase adenylyltransferase (EC 2.7.7.42)| ([Glutamate--ammonia-ligase] adenylyltransferase) (Glutamine-synthetase adenylyltransferase) (ATase) Length = 938 Score = 28.1 bits (61), Expect = 6.3 Identities = 17/72 (23%), Positives = 28/72 (38%), Gaps = 13/72 (18%) Frame = -2 Query: 188 RAIRHVNDYAAMLLVDSRYAHTSSSRGFSCPVEKLPQ-------------WIKARLTCGQ 48 +A+ V ++ + VD R S C + L WIKAR+ G+ Sbjct: 228 QALADVTEHGQVFRVDMRLRPNGDSGPLVCSFDMLENYFITQGREWERYAWIKARVLAGE 287 Query: 47 NYGEVHRLLHQF 12 Y E+ ++ F Sbjct: 288 RYHELEQIARPF 299
>LIPA_MYCLE (O32962) Lipoyl synthase (EC 2.8.1.-) (Lipoic acid synthase)| (Lipoate synthase) (Lipoyl-acyl-carrier protein synthase) (Sulfur insertion protein lipA) (Lip-syn) Length = 314 Score = 27.7 bits (60), Expect = 8.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 113 RGFSCPVEKLPQWIKARLTCGQNYGEVHRLLHQ 15 R P+E+ P WIK R G Y + L+ + Sbjct: 16 RNAQTPIERKPPWIKTRARMGPEYTALKNLVRR 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,798,823 Number of Sequences: 219361 Number of extensions: 473821 Number of successful extensions: 1315 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1309 length of database: 80,573,946 effective HSP length: 58 effective length of database: 67,851,008 effective search space used: 1628424192 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
