| Clone Name | rbags10m23 |
|---|---|
| Clone Library Name | barley_pub |
>PCSK5_MOUSE (Q04592) Proprotein convertase subtilisin/kexin type 5 precursor| (EC 3.4.21.-) (Proprotein convertase PC5) (Subtilisin/kexin-like protease PC5) (PC6) (Subtilisin-like proprotein convertase 6) (SPC6) Length = 1877 Score = 32.3 bits (72), Expect = 1.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 108 VCNRDSHTCRACISYYTCRACKVQLVLR 25 VC + S C+ACI ++ C CK L L+ Sbjct: 738 VCGKCSENCKACIGFHNCTECKGGLSLQ 765
>PAT3_CAEEL (Q27874) Integrin beta pat-3 precursor| Length = 809 Score = 30.4 bits (67), Expect = 5.7 Identities = 15/45 (33%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 177 PSSDSGI*SLSKELHAEVENTCRVCNRDSHTCRACISYY-TCRAC 46 P+SD ++ ++ + E C +RD++TC ACI Y+ +C C Sbjct: 19 PASDWKTGEVTGKVVEKSEFPCYSLSRDNYTCSACIQYHESCAWC 63
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 30.4 bits (67), Expect = 5.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 117 TCRVCNRDSHTCRACISYYTCRACKV 40 T RV +D ++C C Y CR CK+ Sbjct: 954 TLRVVQKDGNSCAWCPQYRFCRGCKI 979
>RSP31_ARATH (P92964) Arginine/serine-rich splicing factor RSP31| Length = 264 Score = 30.0 bits (66), Expect = 7.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 206 DRGRHSLDYGPPVTPAFDRYRRSS 135 D GR S DYG +P +DRYR S Sbjct: 234 DYGRRSSDYGRQRSPGYDRYRSRS 257
>NH125_CAEEL (O17082) Nuclear hormone receptor family member nhr-125| Length = 399 Score = 29.6 bits (65), Expect = 9.7 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 7/26 (26%) Frame = -1 Query: 117 TCRVCNRDSH-------TCRACISYY 61 +CR+CN+ +H TCRAC S++ Sbjct: 12 SCRICNQKAHGNHFGVLTCRACASFF 37
>NHR55_CAEEL (O16962) Nuclear hormone receptor family member nhr-55| Length = 424 Score = 29.6 bits (65), Expect = 9.7 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 10/49 (20%) Frame = -1 Query: 177 PSSDSGI*SLSKELHAEV---ENTCRVCNRDSH-------TCRACISYY 61 PSS S S S + V +TC+VC + SH TCRAC +++ Sbjct: 4 PSSSSSFCSSSSSPSSLVLYSPDTCQVCGQKSHGKHFGAVTCRACAAFF 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,334,140 Number of Sequences: 219361 Number of extensions: 1744923 Number of successful extensions: 3425 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3423 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7366267610 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)