| Clone Name | rbags11b21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU6M_ALBTU (Q08084) NADH-ubiquinone oxidoreductase chain 6 (EC 1... | 31 | 4.0 | 2 | NU6M_ALBCO (P48922) NADH-ubiquinone oxidoreductase chain 6 (EC 1... | 30 | 6.7 |
|---|
>NU6M_ALBTU (Q08084) NADH-ubiquinone oxidoreductase chain 6 (EC 1.6.5.3) (NADH| dehydrogenase subunit 6) (Fragment) Length = 96 Score = 30.8 bits (68), Expect = 4.0 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 144 CVVLFLSQAMMTWLSRVLESIPFESILLLFVYI 46 C VL+L M +W + +L + IL+LF+Y+ Sbjct: 36 CAVLWLGSIMSSWFAYILFIVYIGGILVLFIYV 68
>NU6M_ALBCO (P48922) NADH-ubiquinone oxidoreductase chain 6 (EC 1.6.5.3) (NADH| dehydrogenase subunit 6) Length = 155 Score = 30.0 bits (66), Expect = 6.7 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -1 Query: 144 CVVLFLSQAMMTWLSRVLESIPFESILLLFVYI 46 C VL+L M +W + +L + IL+LF+Y+ Sbjct: 36 CAVLWLGSFMSSWYAYILFIVYIGGILVLFIYV 68 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,527,574 Number of Sequences: 219361 Number of extensions: 1914642 Number of successful extensions: 4771 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4771 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)