| Clone Name | rbags11b19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHP_DROME (P39769) Polyhomeotic-proximal chromatin protein | 29 | 3.7 | 2 | VDH_STRFR (P40176) Valine dehydrogenase (EC 1.4.1.-) (ValDH) | 28 | 8.3 |
|---|
>PHP_DROME (P39769) Polyhomeotic-proximal chromatin protein| Length = 1589 Score = 28.9 bits (63), Expect = 3.7 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +1 Query: 64 TNRHGTPSSSRRNEKT-DTPPLITANTLPTHTLLRFDAHTMHXIXRRPGPGXSWAS 228 ++RHGTP + RR T TP +A + P HT + + PG A+ Sbjct: 140 SHRHGTPPTGRRQTHTPSTPNRPSAPSTPNTNCNSIARHTSLTLEKAQNPGQQVAA 195
>VDH_STRFR (P40176) Valine dehydrogenase (EC 1.4.1.-) (ValDH)| Length = 370 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +2 Query: 68 TDTAHPRLADETKRL-TLHHSSQQTRYRLILCFD 166 TD +HP AD+ L TL S Q R++LC D Sbjct: 1 TDASHPTAADDLGALSTLFRSEQGGHERVLLCQD 34 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,485,263 Number of Sequences: 219361 Number of extensions: 443561 Number of successful extensions: 1143 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1141 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)