| Clone Name | rbags11b18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ASPG1_ARATH (P50287) L-asparaginase 1 precursor (EC 3.5.1.1) (L-... | 35 | 0.26 | 2 | GYRB_MYXXA (O33367) DNA gyrase subunit B (EC 5.99.1.3) | 32 | 1.7 | 3 | CCP3_HUMAN (Q9UKA8) Calcipressin-3 (Down syndrome candidate regi... | 31 | 3.7 | 4 | CCP3_MOUSE (Q9JKK0) Calcipressin-3 (Down syndrome candidate regi... | 31 | 3.7 | 5 | DIP2C_HUMAN (Q9Y2E4) Disco-interacting protein 2 homolog C | 30 | 8.3 |
|---|
>ASPG1_ARATH (P50287) L-asparaginase 1 precursor (EC 3.5.1.1) (L-asparagine| amidohydrolase 1) [Contains: L-asparaginase 1 alpha subunit; L-asparaginase 1 beta subunit] Length = 315 Score = 34.7 bits (78), Expect = 0.26 Identities = 24/59 (40%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = -3 Query: 629 DARRLPRRWRKLPAHGLGARALHTPEPDMDAARL-QREGRRHP--QRGRGGVRAAQDTV 462 D RR+PR LG AL + +P +D A L RE HP G+G V AQ TV Sbjct: 21 DERRIPRESALRHCLDLGISALKSGKPPLDVAELVVRELENHPDFNAGKGSVLTAQGTV 79
>GYRB_MYXXA (O33367) DNA gyrase subunit B (EC 5.99.1.3)| Length = 815 Score = 32.0 bits (71), Expect = 1.7 Identities = 20/55 (36%), Positives = 26/55 (47%) Frame = +3 Query: 387 CRTQQAPSTTGRSWSFTSVRFWRHAHRVLSRANASTATLRMSPTFSLKACCVHVR 551 CRT PSTT RSW T R R ++T + R T+S + C H+R Sbjct: 663 CRT---PSTTPRSWCSTPTRM-----EPCGRRCSTTPSCRRRSTWSCRLCAEHLR 709
>CCP3_HUMAN (Q9UKA8) Calcipressin-3 (Down syndrome candidate region 1-like| protein 2) (Myocyte-enriched calcineurin-interacting protein 3) (MCIP3) Length = 241 Score = 30.8 bits (68), Expect = 3.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 430 LQDLPVVLGACCVLHNICEMRREELEPEVQFALFDDDTT 314 L DLP L AC V + E R ++ E F ++DD T Sbjct: 42 LSDLPTSLFACSVHEAVFEAREQKERFEALFTIYDDQVT 80
>CCP3_MOUSE (Q9JKK0) Calcipressin-3 (Down syndrome candidate region 1-like| protein 2) (Myocyte-enriched calcineurin-interacting protein 3) (MCIP3) Length = 239 Score = 30.8 bits (68), Expect = 3.7 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 430 LQDLPVVLGACCVLHNICEMRREELEPEVQFALFDDDTT 314 L DLP L AC V + E++ ++ E F L+DD T Sbjct: 42 LSDLPTSLFACSVHEAVFEVQEQKERFEALFTLYDDQVT 80
>DIP2C_HUMAN (Q9Y2E4) Disco-interacting protein 2 homolog C| Length = 1556 Score = 29.6 bits (65), Expect = 8.3 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 476 PRERLHG-HVADVADLLVEGVLRPCQVLVC 562 P+ L G H+++ L +EG L PC VL+C Sbjct: 886 PKTPLGGIHLSETKQLFLEGSLHPCNVLMC 915 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,360,672 Number of Sequences: 219361 Number of extensions: 1740770 Number of successful extensions: 4983 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4974 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)