| Clone Name | rbags10m07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZEP1_HUMAN (P15822) Zinc finger protein 40 (Human immunodeficien... | 32 | 0.94 | 2 | DNMT1_MOUSE (P13864) DNA (cytosine-5)-methyltransferase 1 (EC 2.... | 31 | 2.1 | 3 | PACC_MAGGR (Q52B93) pH-response transcription factor pacC/RIM101 | 30 | 3.6 |
|---|
>ZEP1_HUMAN (P15822) Zinc finger protein 40 (Human immunodeficiency virus type| I enhancer-binding protein 1) (HIV-EP1) (Major histocompatibility complex-binding protein 1) (MBP-1) (Positive regulatory domain II-binding factor 1) (PRDII-BF1) Length = 2717 Score = 32.3 bits (72), Expect = 0.94 Identities = 20/65 (30%), Positives = 31/65 (47%) Frame = +3 Query: 159 QSHGEIGGPKRAIPASYTTHKSAFSRQPCGNK*QEPANANDLYNSQSAHVQLINRHSRTL 338 Q+ E+ ++ SYT H SA + G +A+ LY+ V N+H++ L Sbjct: 246 QTSQELVAESQSSCTSYTVHMSAAQKNEQGAM----QSASHLYHQHEHFVPKSNQHNQQL 301 Query: 339 CGCSG 353 GCSG Sbjct: 302 PGCSG 306
>DNMT1_MOUSE (P13864) DNA (cytosine-5)-methyltransferase 1 (EC 2.1.1.37) (Dnmt1)| (DNA methyltransferase MmuI) (DNA MTase MmuI) (MCMT) (M.MmuI) (Met-1) Length = 1620 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 4/45 (8%) Frame = -3 Query: 550 AEPELPAPTRIEAANSDRGKQK----TRKKAPTQTLPILTRTPRR 428 AEPE AP E + D ++K TRKK + T+P+ +R+ R+ Sbjct: 299 AEPEQVAPETPEDRDEDEREEKRRKTTRKKLESHTVPVQSRSERK 343
>PACC_MAGGR (Q52B93) pH-response transcription factor pacC/RIM101| Length = 559 Score = 30.4 bits (67), Expect = 3.6 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +1 Query: 196 SQQATLHTNQHSAGSLAGTSNRNQPTPTISTTASQPMFN*SIVIR 330 +QQA T + S + SN N P P+ STTA+ + S++ R Sbjct: 11 AQQAPATTQAPTTESSSSNSNGNTPAPSTSTTATSQSSDDSLICR 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,163,559 Number of Sequences: 219361 Number of extensions: 1206345 Number of successful extensions: 3190 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3019 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3181 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4585734400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)