| Clone Name | rbags10i20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | POTI_ECOLI (P0AFL1) Putrescine transport system permease protein... | 30 | 6.1 | 2 | POTI_ECOL6 (P0AFL2) Putrescine transport system permease protein... | 30 | 6.1 | 3 | ITF2_CANFA (P15881) Transcription factor 4 (Immunoglobulin trans... | 30 | 8.0 |
|---|
>POTI_ECOLI (P0AFL1) Putrescine transport system permease protein potI| Length = 281 Score = 30.0 bits (66), Expect = 6.1 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -3 Query: 370 MLIWKFMIHRRICVWRSWDTNVLRSYGSQRLEGILPEFVGISVVLKAC 227 ++I+ F + + VW W T R YG + + VG+S+ + AC Sbjct: 30 LVIYSFNSSKLVTVWAGWST---RWYGELLRDDAMMSAVGLSLTIAAC 74
>POTI_ECOL6 (P0AFL2) Putrescine transport system permease protein potI| Length = 281 Score = 30.0 bits (66), Expect = 6.1 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = -3 Query: 370 MLIWKFMIHRRICVWRSWDTNVLRSYGSQRLEGILPEFVGISVVLKAC 227 ++I+ F + + VW W T R YG + + VG+S+ + AC Sbjct: 30 LVIYSFNSSKLVTVWAGWST---RWYGELLRDDAMMSAVGLSLTIAAC 74
>ITF2_CANFA (P15881) Transcription factor 4 (Immunoglobulin transcription| factor 2) (ITF-2) (Thyroglobulin promoter transcription factor TFE) Length = 642 Score = 29.6 bits (65), Expect = 8.0 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 2/49 (4%) Frame = +2 Query: 503 HIPTPWHSSSSLIYP--GGNLGSLSSIMVPRSFSKVTPFSLVCAHPHST 643 H PW SSS + P GG LGS S I S+ + P + HS+ Sbjct: 197 HSSDPWSSSSGMNQPGYGGMLGSSSHIPQSSSYCSLHPHERLSYPSHSS 245 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,461,094 Number of Sequences: 219361 Number of extensions: 2153507 Number of successful extensions: 4213 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4120 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4213 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)