| Clone Name | rbags10e07 |
|---|---|
| Clone Library Name | barley_pub |
>ISAM1_ARATH (Q8LBM4) Iron-sulfur assembly protein IscA-like 1, mitochondrial| precursor Length = 137 Score = 123 bits (308), Expect = 6e-28 Identities = 55/68 (80%), Positives = 64/68 (94%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 +EKGKFDELVEEKGV++L++PKALMHVIGTKMDFVDD LRSEFVFINPNS+G+CGCGESF Sbjct: 65 DEKGKFDELVEEKGVRILVEPKALMHVIGTKMDFVDDKLRSEFVFINPNSQGQCGCGESF 124 Query: 325 MTTGSKGS 302 MTT + + Sbjct: 125 MTTSTSSA 132
>ISAM3_ARATH (Q8L8C0) Iron-sulfur assembly protein IscA-like 3, mitochondrial| precursor Length = 109 Score = 109 bits (272), Expect = 9e-24 Identities = 50/63 (79%), Positives = 59/63 (93%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 +EKGKFDE+VEEKGVK+L+DPKA+MHVIGT+MDFVDD LRSEFVF+NPN+ +CGCGESF Sbjct: 48 QEKGKFDEVVEEKGVKILVDPKAVMHVIGTEMDFVDDKLRSEFVFVNPNAT-KCGCGESF 106 Query: 325 MTT 317 TT Sbjct: 107 TTT 109
>ISA1_YEAST (Q07821) Iron sulfur assembly protein 1| Length = 250 Score = 92.4 bits (228), Expect = 1e-18 Identities = 41/60 (68%), Positives = 51/60 (85%) Frame = -1 Query: 502 EKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESFM 323 E GKFDE+VE+ GVK++ID KAL +IG++MD++DD L S+FVF NPNSKG CGCGESFM Sbjct: 190 EPGKFDEVVEQDGVKIVIDSKALFSIIGSEMDWIDDKLASKFVFKNPNSKGTCGCGESFM 249
>Y484_RICPR (Q9ZD62) Hypothetical protein RP484| Length = 110 Score = 85.9 bits (211), Expect = 1e-16 Identities = 34/60 (56%), Positives = 49/60 (81%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 + K +FDE+VEEKGV++LIDPK LM+++G++MD+V+ +S+F F NPN K CGCG+SF Sbjct: 49 DNKNQFDEVVEEKGVRILIDPKTLMYILGSEMDYVETNFKSQFTFTNPNEKANCGCGKSF 108
>ISA1_SCHPO (P78859) Iron sulfur assembly protein 1| Length = 190 Score = 75.9 bits (185), Expect = 1e-13 Identities = 31/62 (50%), Positives = 46/62 (74%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 E+ KFDE+V++ G+ +++ +AL+ +IG+ MD+ DD L+S F+F NPN K CGCGESF Sbjct: 127 EKPDKFDEIVKQDGISIIVARRALLQIIGSVMDYRDDDLQSRFIFSNPNVKSTCGCGESF 186 Query: 325 MT 320 T Sbjct: 187 ST 188
>HBLD2_CHICK (Q5ZJ74) HESB-like domain-containing protein 2, mitochondrial| precursor (Iron sulfur assembly protein IscA) Length = 129 Score = 75.9 bits (185), Expect = 1e-13 Identities = 35/60 (58%), Positives = 45/60 (75%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 + KG DE V + GV+V I+ KA + ++GT+MD+V+D L SEFVF NPN KG CGCGESF Sbjct: 68 KSKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESF 127
>HBLD2_RAT (Q80W96) HESB-like domain-containing protein 2, mitochondrial| precursor (Iron sulfur assembly protein IscA) Length = 129 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = -1 Query: 499 KGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 KG DE V + GV+V I+ KA + ++GT+MD+V+D L SEFVF NPN KG CGCGESF Sbjct: 70 KGDADEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESF 127
>HBLD2_MOUSE (Q9D924) HESB-like domain-containing protein 2, mitochondrial| precursor (Iron sulfur assembly protein IscA) Length = 129 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = -1 Query: 499 KGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 KG DE V + GV+V I+ KA + ++GT+MD+V+D L SEFVF NPN KG CGCGESF Sbjct: 70 KGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESF 127
>HBLD2_MACFA (Q4R5F0) HESB-like domain-containing protein 2, mitochondrial| precursor (Iron sulfur assembly protein IscA) Length = 129 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = -1 Query: 499 KGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 KG DE V + GV+V I+ KA + ++GT+MD+V+D L SEFVF NPN KG CGCGESF Sbjct: 70 KGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESF 127
>HBLD2_HUMAN (Q9BUE6) HESB-like domain-containing protein 2, mitochondrial| precursor (Iron sulfur assembly protein IscA) (hIscA) Length = 129 Score = 75.1 bits (183), Expect = 2e-13 Identities = 35/58 (60%), Positives = 44/58 (75%) Frame = -1 Query: 499 KGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 KG DE V + GV+V I+ KA + ++GT+MD+V+D L SEFVF NPN KG CGCGESF Sbjct: 70 KGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESF 127
>HBLD2_BRARE (Q4QRC6) HESB-like domain-containing protein 2, mitochondrial| precursor (Iron sulfur assembly protein IscA) Length = 129 Score = 71.6 bits (174), Expect = 2e-12 Identities = 34/60 (56%), Positives = 44/60 (73%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 + K + DE V + GV+V I+ KA + ++GT+MDFV+ L SEFVF NPN KG CGCGESF Sbjct: 68 KNKEQSDEEVLQDGVRVFIEKKAQLTLLGTEMDFVETKLSSEFVFNNPNIKGTCGCGESF 127
>ISCA_ERWCT (Q6D261) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 68.9 bits (167), Expect = 1e-11 Identities = 30/54 (55%), Positives = 41/54 (75%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L+++ GT++DFV + L F F NPN GECGCGESF Sbjct: 52 DTVFEDKGVKVIVDGKSLVYLDGTELDFVKEGLNEGFKFNNPNISGECGCGESF 105
>ISCA_XENNE (Q8GLE6) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 67.4 bits (163), Expect = 4e-11 Identities = 28/54 (51%), Positives = 41/54 (75%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D++ E+KGVKV++D K+++++ GT++DFV + L F F NPN ECGCGESF Sbjct: 52 DQVFEDKGVKVIVDGKSILYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESF 105
>ISCA_SALTY (Q7CQ12) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L + GT++DFV + L F F NPN K ECGCGESF Sbjct: 52 DTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESF 105
>ISCA_SALTI (Q8XFZ8) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L + GT++DFV + L F F NPN K ECGCGESF Sbjct: 52 DTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESF 105
>ISCA_SALPA (Q5PNG5) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L + GT++DFV + L F F NPN K ECGCGESF Sbjct: 52 DTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESF 105
>ISCA_SALCH (Q57LH1) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L + GT++DFV + L F F NPN K ECGCGESF Sbjct: 52 DTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESF 105
>ISCA_SHIFL (P0AAD1) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 66.2 bits (160), Expect = 9e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L + GT++DFV + L F F NPN K ECGCGESF Sbjct: 52 DIVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESF 105
>ISCA_ECOLI (P0AAC8) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 66.2 bits (160), Expect = 9e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L + GT++DFV + L F F NPN K ECGCGESF Sbjct: 52 DIVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESF 105
>ISCA_ECOL6 (P0AAC9) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 66.2 bits (160), Expect = 9e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L + GT++DFV + L F F NPN K ECGCGESF Sbjct: 52 DIVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESF 105
>ISCA_ECO57 (P0AAD0) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 66.2 bits (160), Expect = 9e-11 Identities = 30/54 (55%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+L + GT++DFV + L F F NPN K ECGCGESF Sbjct: 52 DIVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKDECGCGESF 105
>ISCA_PHOLL (Q7N226) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 65.9 bits (159), Expect = 1e-10 Identities = 28/54 (51%), Positives = 40/54 (74%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV++D K+++++ GT++DFV + L F F NPN ECGCGESF Sbjct: 52 DTVFEDKGVKVIVDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESF 105
>ISCA_YERPS (Q667Y3) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/54 (53%), Positives = 40/54 (74%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV+ID K+++++ GT++DFV + L F F NPN ECGCGESF Sbjct: 52 DIVFEDKGVKVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESF 105
>ISCA_YERPE (Q8ZCS3) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/54 (53%), Positives = 40/54 (74%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E+KGVKV+ID K+++++ GT++DFV + L F F NPN ECGCGESF Sbjct: 52 DIVFEDKGVKVIIDGKSMVYLDGTELDFVKEGLNEGFKFNNPNVSNECGCGESF 105
>ISCA_HAEIN (P44672) Iron-binding protein iscA (Iron-sulfur cluster assembly| protein) Length = 107 Score = 60.8 bits (146), Expect = 4e-09 Identities = 24/54 (44%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D++ E+ GV +++DPK+L+++ G ++D+V + L F + NPN K CGCGESF Sbjct: 52 DQVFEQYGVNIIVDPKSLVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGESF 105
>YNIU_RHOSH (Q01195) Hypothetical 10.8 kDa protein in nifU 5'region (ORF 1)| Length = 106 Score = 58.2 bits (139), Expect = 2e-08 Identities = 27/54 (50%), Positives = 39/54 (72%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +VE +G++VLIDP++ ++ G +DFV + FVF NPN+KG CGCG+SF Sbjct: 52 DLVVEAEGLRVLIDPQSGTYLNGVTIDFVTSLEGTGFVFDNPNAKGGCGCGKSF 105
>Y1857_AQUAE (O67709) Protein aq_1857| Length = 116 Score = 55.8 bits (133), Expect = 1e-07 Identities = 25/54 (46%), Positives = 35/54 (64%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D + E GVKV+IDP ++ +V G ++D+V D + F NPN+ G CGCG SF Sbjct: 60 DHVFEYDGVKVVIDPFSMPYVNGAELDYVVDFMGGGFTIRNPNATGSCGCGSSF 113
>YADR_SHIFL (P0ACC6) Hypothetical protein yadR| Length = 114 Score = 55.1 bits (131), Expect = 2e-07 Identities = 21/54 (38%), Positives = 36/54 (66%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +E++GV +++DP +L +++G +D+ + S F+ NPN+K CGCG SF Sbjct: 59 DMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSF 112
>YADR_ECOLI (P0ACC3) Hypothetical protein yadR| Length = 114 Score = 55.1 bits (131), Expect = 2e-07 Identities = 21/54 (38%), Positives = 36/54 (66%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +E++GV +++DP +L +++G +D+ + S F+ NPN+K CGCG SF Sbjct: 59 DMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSF 112
>YADR_ECOL6 (P0ACC4) Hypothetical protein yadR| Length = 114 Score = 55.1 bits (131), Expect = 2e-07 Identities = 21/54 (38%), Positives = 36/54 (66%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +E++GV +++DP +L +++G +D+ + S F+ NPN+K CGCG SF Sbjct: 59 DMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSF 112
>YADR_ECO57 (P0ACC5) Hypothetical protein yadR| Length = 114 Score = 55.1 bits (131), Expect = 2e-07 Identities = 21/54 (38%), Positives = 36/54 (66%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +E++GV +++DP +L +++G +D+ + S F+ NPN+K CGCG SF Sbjct: 59 DMTIEKQGVGLVVDPMSLQYLVGGSVDYTEGLEGSRFIVTNPNAKSTCGCGSSF 112
>HESB_PLEBO (P46053) Protein hesB| Length = 121 Score = 55.1 bits (131), Expect = 2e-07 Identities = 26/57 (45%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -1 Query: 493 KFDELVEEKG-VKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 K D+++E++G VK+ IDP+A + G +DFV+ + S F F NPN+ CGCG+SF Sbjct: 52 KPDDVIEQQGRVKIYIDPQAAALINGVVVDFVEGLMDSGFKFSNPNATDTCGCGQSF 108
>Y405_XYLFA (P64342) Hypothetical protein Xf0405| Length = 128 Score = 54.7 bits (130), Expect = 3e-07 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 E + D +E GV +L+DP +L +++G ++D+ + ++FV NPN+K CGCG SF Sbjct: 67 ENRADDDLALETDGVVLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSF 126
>Y1667_XYLFT (P64343) Hypothetical protein PD1667| Length = 128 Score = 54.7 bits (130), Expect = 3e-07 Identities = 23/60 (38%), Positives = 38/60 (63%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 E + D +E GV +L+DP +L +++G ++D+ + ++FV NPN+K CGCG SF Sbjct: 67 ENRADDDLALETDGVVLLVDPLSLQYLLGAEVDYTESLTGAKFVIRNPNAKTTCGCGSSF 126
>SUFA_ECOLI (P77667) Protein sufA| Length = 122 Score = 54.7 bits (130), Expect = 3e-07 Identities = 26/59 (44%), Positives = 36/59 (61%) Frame = -1 Query: 502 EKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 E K D L E G K+ + +A+ + GT++DFV + L F F NP ++ ECGCGESF Sbjct: 62 EPDKDDLLFEHDGAKLFVPLQAMPFIDGTEVDFVREGLNQIFKFHNPKAQNECGCGESF 120
>YNIU_RHOCA (Q07184) Hypothetical 11.0 kDa protein in nifU 5'region (ORF6)| Length = 106 Score = 54.3 bits (129), Expect = 3e-07 Identities = 25/46 (54%), Positives = 31/46 (67%) Frame = -1 Query: 463 VKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 V VLIDP H+ GTK+DFV + + F F NPN+K CGCG+SF Sbjct: 60 VTVLIDPLTREHIEGTKIDFVSNLEGAGFTFDNPNAKSACGCGKSF 105
>YUTM_BACSU (O32113) Hypothetical protein yutM| Length = 120 Score = 53.5 bits (127), Expect = 6e-07 Identities = 25/71 (35%), Positives = 38/71 (53%) Frame = -1 Query: 502 EKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESFM 323 EK + D + ++ G+ VL+D ++L + GT +D+ L F NPN+ CGCG SF Sbjct: 50 EKSESDSVFDQHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSFR 109 Query: 322 TTGSKGSTS*C 290 T + G C Sbjct: 110 TATNAGKPEEC 120
>Y1755_BRAJA (P37029) Hypothetical protein blr1755| Length = 106 Score = 53.5 bits (127), Expect = 6e-07 Identities = 24/54 (44%), Positives = 34/54 (62%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +++ G+KV +D K+ H+ GT +DFV P S F F NPN+ C CG+SF Sbjct: 52 DTVIDCDGLKVFVDSKSREHLAGTTIDFVLAPESSGFTFHNPNAATNCSCGKSF 105
>YNIU_AZOVI (Q44540) Hypothetical 11.0 kDa protein in nifU 5'region (ORF6)| Length = 107 Score = 53.1 bits (126), Expect = 8e-07 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = -1 Query: 505 EEKG-KFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGES 329 EE G + D+LV+ G+ +LID + + G MDFV+ S F F+NPN+ CGCG+S Sbjct: 45 EEAGAEDDQLVDCDGITLLIDSASAPLLDGVTMDFVESMEGSGFTFVNPNATNSCGCGKS 104 Query: 328 F 326 F Sbjct: 105 F 105
>Y211_BUCAI (P57307) Hypothetical protein BU211| Length = 114 Score = 51.6 bits (122), Expect = 2e-06 Identities = 20/54 (37%), Positives = 37/54 (68%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D ++ + V ++IDP +L ++ G ++D++++ S+F+ NPN+K CGCG SF Sbjct: 59 DIIITQSEVSLIIDPISLQYLYGGQIDYLENLEGSKFIVYNPNAKNTCGCGSSF 112
>Y1723_HAEIN (P45344) Protein HI1723| Length = 114 Score = 51.6 bits (122), Expect = 2e-06 Identities = 22/54 (40%), Positives = 34/54 (62%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +E+ GV+++IDP +L ++IG +D+ + S F NPN+ CGCG SF Sbjct: 59 DLTIEKSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATSTCGCGSSF 112
>ISCAP_ARATH (Q9XIK3) Iron-sulfur assembly protein IscA, chloroplast precursor| (Protein Scaffold protein AtCpIscA) Length = 180 Score = 51.2 bits (121), Expect = 3e-06 Identities = 20/54 (37%), Positives = 34/54 (62%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +E +G ++ DPK+++ + G ++D+ D + F F NPN+ CGCG+SF Sbjct: 123 DSTIEYQGFTIVCDPKSMLFLFGMQLDYSDALIGGGFSFSNPNATQTCGCGKSF 176
>Y684_HAEDU (Q9X4A0) Hypothetical protein HD_0684| Length = 114 Score = 50.1 bits (118), Expect = 7e-06 Identities = 21/54 (38%), Positives = 33/54 (61%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D +E + V +++DP +L ++IG +D+ + S FV NPN+ CGCG SF Sbjct: 59 DLTIENQNVGLIVDPMSLQYLIGGSVDYTEGLDGSRFVVQNPNASSTCGCGSSF 112
>Y4VC_RHISN (Q53211) Hypothetical 11.0 kDa protein y4vC| Length = 106 Score = 49.7 bits (117), Expect = 9e-06 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D ++E GVKV +D + HV G +DF + F+F NPN++ C CG+SF Sbjct: 52 DAVIEAGGVKVYVDSASQPHVSGMTVDFTTGVDSAGFIFDNPNARENCACGKSF 105
>Y193_BUCBP (Q89AQ6) Hypothetical protein bbp_193| Length = 115 Score = 49.3 bits (116), Expect = 1e-05 Identities = 21/60 (35%), Positives = 38/60 (63%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 + K K D +V ++IDP +L ++ G ++D++++ S+F+ +NP +K CGCG SF Sbjct: 54 KNKNKNDTIVNIFNNIIIIDPISLQYLRGGQIDYIENLEGSKFIILNPKAKHTCGCGSSF 113
>Y2227_MYCBO (P0A5B0) Protein Mb2227c| Length = 118 Score = 48.9 bits (115), Expect = 1e-05 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D+ E GV++++D + +V G +DFVD + F NPN+ G C CG+SF Sbjct: 64 DQTAEFGGVRLIVDRMSAPYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSF 117
>Y2204_MYCTU (P0A5A9) Protein Rv2204c/MT2260| Length = 118 Score = 48.9 bits (115), Expect = 1e-05 Identities = 21/54 (38%), Positives = 32/54 (59%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D+ E GV++++D + +V G +DFVD + F NPN+ G C CG+SF Sbjct: 64 DQTAEFGGVRLIVDRMSAPYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSF 117
>Y205_BUCAP (O51930) Hypothetical protein BUsg205| Length = 114 Score = 48.5 bits (114), Expect = 2e-05 Identities = 22/60 (36%), Positives = 40/60 (66%) Frame = -1 Query: 505 EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 E+ + D LV++ + ++IDP +L ++ G +D++++ S+F+ NPN+K CGCG SF Sbjct: 53 EKINEDDILVKKLNICLVIDPISLQYLHGGTIDYLENLEGSKFIVSNPNAKNTCGCGLSF 112
>Y1417_SYNY3 (P72731) Hypothetical protein slr1417| Length = 118 Score = 48.5 bits (114), Expect = 2e-05 Identities = 19/54 (35%), Positives = 35/54 (64%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 DE+ + +G +++ D K+L+++ G +D+ + + F F NPN+ CGCG+SF Sbjct: 63 DEVFDYEGFQIICDRKSLLYLYGLMLDYSNALIGGGFQFTNPNANQTCGCGKSF 116
>HESB1_ANAVT (P46051) Protein hesB, heterocyst| Length = 123 Score = 48.1 bits (113), Expect = 3e-05 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = -1 Query: 487 DELVEEKG-VKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D+LV ++G V V +D K+ + G +DFV+ + S F F NPN+ CGCG+SF Sbjct: 56 DDLVSQQGSVLVYVDAKSAPLLEGIVIDFVEGLVESGFKFTNPNATSTCGCGKSF 110
>HESB_ANASP (P18501) Protein hesB| Length = 123 Score = 47.8 bits (112), Expect = 3e-05 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = -1 Query: 487 DELVEEKG-VKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D+LV ++G V V +D K+ + G +DFV+ + S F F NPN+ CGCG+SF Sbjct: 56 DDLVTQQGSVLVYVDAKSAPLLEGIVIDFVEGLVESGFKFTNPNATSTCGCGKSF 110
>YNIU_AZOBR (Q43895) Hypothetical 12.5 kDa protein in nifU 5'region (ORF2)| Length = 125 Score = 47.4 bits (111), Expect = 4e-05 Identities = 24/64 (37%), Positives = 37/64 (57%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESFMTTGSK 308 D+++ V + +DP + + G +DFV+ + F F NPN+ G CGCG+SF + G Sbjct: 51 DDVLTFGPVTIFVDPTSQPFLTGVVVDFVEGVEGAGFKFDNPNATGSCGCGKSF-SAGPG 109 Query: 307 GSTS 296 GS S Sbjct: 110 GSCS 113
>HESB2_ANAVT (P46052) Protein hesB, vegetative| Length = 123 Score = 47.0 bits (110), Expect = 6e-05 Identities = 22/55 (40%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -1 Query: 487 DELVEEKG-VKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D++V ++G +++ +D ++ + G +DFVD L S F F NPN+ CGCG+SF Sbjct: 56 DDMVLQQGKLRIYVDSQSAPLLEGVVVDFVDGLLESGFKFSNPNATDTCGCGKSF 110
>YCF83_PORPU (P51217) Hypothetical 12.4 kDa protein ycf83 (ORF114)| Length = 114 Score = 47.0 bits (110), Expect = 6e-05 Identities = 20/54 (37%), Positives = 32/54 (59%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 DE++ V DPK+L+++ G +D+ + + F F NPN+ CGCG+SF Sbjct: 59 DEVLMLDSFLVACDPKSLLYLYGLSLDYSSELIGGGFQFSNPNASQTCGCGKSF 112
>Y114_BUCAP (Q8KA13) Hypothetical protein BUsg114| Length = 129 Score = 46.2 bits (108), Expect = 1e-04 Identities = 25/66 (37%), Positives = 34/66 (51%) Frame = -1 Query: 523 VRTN**EEKGKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGEC 344 V+ N E++ K D + + V I K + G K+DFV D + F + NP K C Sbjct: 61 VKNNTIEKENKNDIVFYYNNILVYISLKEAPFLNGIKIDFVKDSINEVFKYCNPRIKTFC 120 Query: 343 GCGESF 326 GCGESF Sbjct: 121 GCGESF 126
>YCF83_GALSU (Q9MSA1) Hypothetical 12.5 kDa protein ycf83 (ORF339)| Length = 112 Score = 43.5 bits (101), Expect = 6e-04 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = -1 Query: 457 VLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 ++ D K+++++ G +D+ + F F+NPN+K CGCG+SF Sbjct: 68 LVCDNKSILYLYGISLDYSSSLIDGGFKFLNPNAKQTCGCGKSF 111
>YNIU_FRAAL (Q47887) Hypothetical 14.1 kDa protein in nifB-nifU intergenic| region (ORF2) Length = 135 Score = 42.7 bits (99), Expect = 0.001 Identities = 18/54 (33%), Positives = 30/54 (55%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 D ++ + G V++ + + G ++D+ + S F F NPN+K CGCG SF Sbjct: 59 DVVLPQDGFDVVVHTTGVDLLRGMRVDYTETLTSSGFTFANPNAKSSCGCGSSF 112
>ISAM2_ARATH (Q8LCY2) Iron-sulfur assembly protein IscA-like 2, mitochondrial| precursor Length = 158 Score = 42.4 bits (98), Expect = 0.001 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 1/56 (1%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVF-INPNSKGECGCGESFM 323 D + E+ GVK+++D + V G +D+ ++ +R+ FV +NP++ G C C SFM Sbjct: 100 DRVFEKNGVKLVVDNVSYDLVKGATIDYEEELIRAAFVVAVNPSAVGGCSCKSSFM 155
>ISA2_YEAST (Q12425) Iron sulfur assembly protein 2| Length = 185 Score = 41.6 bits (96), Expect = 0.002 Identities = 21/52 (40%), Positives = 32/52 (61%) Frame = -1 Query: 481 LVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 L E+KG +V+ID K+L + T + + ++ + S F IN + K CGCG SF Sbjct: 131 LPEDKG-RVIIDSKSLNILNNTTLTYTNELIGSSFKIINGSLKSSCGCGSSF 181
>Y1565_SYNY3 (P74596) Hypothetical protein slr1565| Length = 113 Score = 40.0 bits (92), Expect = 0.007 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -1 Query: 475 EEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 E GV VL+D ++ ++ K+D+ +D + F F NPN+ C C SF Sbjct: 56 ESGGVTVLVDSQSAGYLHNLKLDYAEDLMGGGFRFTNPNAAQVCSCSLSF 105
>Y063_RICPR (Q9ZE83) Hypothetical protein RP063| Length = 110 Score = 38.1 bits (87), Expect = 0.026 Identities = 17/56 (30%), Positives = 29/56 (51%) Frame = -1 Query: 493 KFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 K D + ++ID + ++ +DF+++ S F NP +K +CGCG SF Sbjct: 53 KDDYVFTRHNATIIIDSISQKFMLNCTLDFIEELGSSYFNVSNPQAKAKCGCGNSF 108
>Y116_BUCBP (Q89AW2) Hypothetical protein bbp_116| Length = 128 Score = 37.7 bits (86), Expect = 0.034 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = -1 Query: 463 VKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 V ++++ L + G K+DFV + L F F + K CGCG SF Sbjct: 81 VSIIVNTNELHMLDGVKIDFVKEGLNYSFKFSHTKIKNFCGCGNSF 126
>Y122_BUCAI (P57222) Hypothetical protein BU122| Length = 130 Score = 34.7 bits (78), Expect = 0.29 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -1 Query: 469 KGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGESF 326 + + + I K + + G ++DFV + + F F N + CGCGESF Sbjct: 80 QNILIYIYSKDIPFLEGIRIDFVKNNINKIFKFYNTKLEKFCGCGESF 127
>ISA2_SCHPO (O43045) Iron sulfur assembly protein 2| Length = 205 Score = 32.3 bits (72), Expect = 1.4 Identities = 16/58 (27%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = -1 Query: 496 GKFDELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFIN-PNSKGECGCGESF 326 G D + +V+ D +L + G+++++ ++ + S F +N P +K CGC SF Sbjct: 145 GNADTVFVRGKARVVADNISLPLISGSEIEYTNELIGSSFQLLNNPRAKTSCGCNVSF 202
>DOT1L_DROME (Q8INR6) Histone-lysine N-methyltransferase, H3 lysine-79 specific| (EC 2.1.1.43) (Histone H3-K79 methyltransferase) (H3-K79-HMTase) (Protein grappa) (DOT1-like protein) (dDOT1L) Length = 1848 Score = 31.2 bits (69), Expect = 3.2 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = +3 Query: 276 HHSMTHHDVDPLLPVVMKDSPHPHSPFEFGFMNTNSDLSGSSTKSILV 419 HH HH L V PH H P EF +S L SS++ L+ Sbjct: 1240 HHHHHHHPQHRLPQHVQHQHPHQHHPNEFKAPPADSHLQRSSSREQLI 1287
>NADE_LACLA (Q9CGJ4) NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5)| Length = 274 Score = 30.0 bits (66), Expect = 7.1 Identities = 20/53 (37%), Positives = 31/53 (58%) Frame = -1 Query: 487 DELVEEKGVKVLIDPKALMHVIGTKMDFVDDPLRSEFVFINPNSKGECGCGES 329 DE+++E GVK +IDPK + V +DF+ D L+ ++ FI G G +S Sbjct: 5 DEIIKELGVKPVIDPKEEIRV---SVDFLKDYLK-KYPFIKSFVLGISGGQDS 53
>LBD16_ARATH (Q9SLB7) LOB domain protein 16| Length = 245 Score = 29.6 bits (65), Expect = 9.2 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +3 Query: 234 SVTRATTAHASLYLHHSMTHHDVDPLLPVVMKDSPHPHSPFEFGFMNTNSDLS 392 SV+ +A+++ Y HH + V+P PV P S E F NT+SD++ Sbjct: 144 SVSPIGSAYSTPYNHHQPYYGHVNPNNPV------SPQSSLEESFSNTSSDVT 190 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 103,078,693 Number of Sequences: 219361 Number of extensions: 2095232 Number of successful extensions: 5120 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 4960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5118 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)