| Clone Name | rbags9n08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYA_ARATH (P36428) Alanyl-tRNA synthetase, mitochondrial precurs... | 62 | 5e-10 | 2 | LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late en... | 32 | 0.78 | 3 | DHSD_MOUSE (Q9CXV1) Succinate dehydrogenase [ubiquinone] cytochr... | 30 | 3.8 |
|---|
>SYA_ARATH (P36428) Alanyl-tRNA synthetase, mitochondrial precursor (EC 6.1.1.7)| (Alanine--tRNA ligase) (AlaRS) Length = 1003 Score = 62.4 bits (150), Expect = 5e-10 Identities = 37/84 (44%), Positives = 52/84 (61%), Gaps = 3/84 (3%) Frame = -3 Query: 455 KSLPIMVFSTDEASNKAVIYAGVPPDAPNGFKVLD---WLTPSIAPXXXXXXXXXXXXXX 285 K + IMVFSTDE++NKAV+ AGV P+ + FK LD WLT ++ P Sbjct: 920 KGMSIMVFSTDESTNKAVVCAGV-PEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLAS 978 Query: 284 XXGSDASRVKEAMELATQIASMKL 213 G+DAS+V+ A+++A+ ASMKL Sbjct: 979 GQGTDASQVQAALDMASSFASMKL 1002
>LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late envelope protein| 18) (Small proline-rich-like epidermal differentiation complex protein 5A) Length = 118 Score = 32.0 bits (71), Expect = 0.78 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 7/61 (11%) Frame = -2 Query: 396 CRRTSGCTQWLQGVGLAYTFNRTTQGKRRRRQEWSCPGP-------GK*CFSGQGGNGAC 238 C +SG +G G + +R Q RRR Q SC G G C GG+G C Sbjct: 52 CGSSSGGCCSSEGGGCCLSHHRPRQSLRRRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCC 111 Query: 237 Y 235 + Sbjct: 112 H 112
>DHSD_MOUSE (Q9CXV1) Succinate dehydrogenase [ubiquinone] cytochrome b small| subunit, mitochondrial precursor (CybS) (Succinate-ubiquinone reductase membrane anchor subunit) (QPs3) (CII-4) (Succinate dehydrogenase complex subunit D) (Succinate-ubiquinone Length = 159 Score = 29.6 bits (65), Expect = 3.8 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -1 Query: 409 RLLYMPAYLRMHPMASRCWIG-LHLQ-SHHSREEEAAARMVLPRAREVMLLG 260 R Y+ A+L+ P RC +HL SHHS + A+ R V+LLG Sbjct: 27 RPAYVSAFLQDQPTQGRCGTQHIHLSPSHHSGSKAASLHWTSERVVSVLLLG 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,019,849 Number of Sequences: 219361 Number of extensions: 1292901 Number of successful extensions: 2867 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2864 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)