| Clone Name | rbags9m20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YJF8_YEAST (P47041) Hypothetical 60.8 kDa protein in BTN1-PEP8 i... | 30 | 7.8 | 2 | GLB_PSEDC (P26914) Extracellular globin precursor | 30 | 7.8 | 3 | YCAJ_ECOLI (P0AAZ4) Hypothetical protein ycaJ | 30 | 7.8 | 4 | YCAJ_ECOL6 (P0AAZ5) Hypothetical protein ycaJ | 30 | 7.8 | 5 | YCAJ_ECO57 (P0AAZ6) Hypothetical protein ycaJ | 30 | 7.8 | 6 | KS6A2_HUMAN (Q15349) Ribosomal protein S6 kinase alpha-2 (EC 2.7... | 30 | 7.8 |
|---|
>YJF8_YEAST (P47041) Hypothetical 60.8 kDa protein in BTN1-PEP8 intergenic| region Length = 543 Score = 29.6 bits (65), Expect = 7.8 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 393 TVIISFAQIGKHINGEYCIEFIGLQCFKNEV 485 TV+ S + HING Y I F+ L CF++ + Sbjct: 442 TVLKSGNESRTHINGNYSIGFLLLMCFRDSI 472
>GLB_PSEDC (P26914) Extracellular globin precursor| Length = 333 Score = 29.6 bits (65), Expect = 7.8 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 5/50 (10%) Frame = +3 Query: 438 EYCIEFIGLQCFKNEVS*HIWEHH*ERF-----HHGEMAPRVTCLSSFSF 572 E+ IEF+G + +E + H W+ + F HHG + R C++S + Sbjct: 131 EHFIEFLGSKTTLDEPTKHAWQEIGKEFSHEISHHGRHSVRDHCMNSLEY 180
>YCAJ_ECOLI (P0AAZ4) Hypothetical protein ycaJ| Length = 447 Score = 29.6 bits (65), Expect = 7.8 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = -1 Query: 509 VMFPDVSADFILEALKANEFDAVLTIDMLSDLCEADDNG 393 ++ PD + I E + + A+ T++M++D+ E DD+G Sbjct: 190 IVLPDETRRAIAELVNGDARRALNTLEMMADMAEVDDSG 228
>YCAJ_ECOL6 (P0AAZ5) Hypothetical protein ycaJ| Length = 447 Score = 29.6 bits (65), Expect = 7.8 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = -1 Query: 509 VMFPDVSADFILEALKANEFDAVLTIDMLSDLCEADDNG 393 ++ PD + I E + + A+ T++M++D+ E DD+G Sbjct: 190 IVLPDETRRAIAELVNGDARRALNTLEMMADMAEVDDSG 228
>YCAJ_ECO57 (P0AAZ6) Hypothetical protein ycaJ| Length = 447 Score = 29.6 bits (65), Expect = 7.8 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = -1 Query: 509 VMFPDVSADFILEALKANEFDAVLTIDMLSDLCEADDNG 393 ++ PD + I E + + A+ T++M++D+ E DD+G Sbjct: 190 IVLPDETRRAIAELVNGDARRALNTLEMMADMAEVDDSG 228
>KS6A2_HUMAN (Q15349) Ribosomal protein S6 kinase alpha-2 (EC 2.7.11.1)| (S6K-alpha 2) (90 kDa ribosomal protein S6 kinase 2) (p90-RSK 2) (Ribosomal S6 kinase 3) (RSK-3) (pp90RSK3) (MAP kinase-activated protein kinase 1c) (MAPKAPK1C) Length = 733 Score = 29.6 bits (65), Expect = 7.8 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +1 Query: 97 PKELYNLQPRITMRQTPTNRPAIPPGI*NPNT*YLLFLG--LVTETLRGEFFAESRNCTP 270 P++ ++ P T R TPT+ P +PP + LF G V +L E + + P Sbjct: 342 PEDTFHFDPEFTAR-TPTDSPGVPPSA----NAHHLFRGFSFVASSLIQEPSQQDLHKVP 396 Query: 271 LHPVL 285 +HP++ Sbjct: 397 VHPIV 401 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,136,528 Number of Sequences: 219361 Number of extensions: 1655099 Number of successful extensions: 4262 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4261 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)