| Clone Name | rbags9j07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | T2M4_METJA (Q58723) Type II restriction enzyme MjaIV (EC 3.1.21.... | 32 | 2.5 | 2 | TFR1_MOUSE (Q62351) Transferrin receptor protein 1 (TfR1) (TR) (... | 31 | 4.2 | 3 | GR85A_DROME (Q8INM9) Putative gustatory receptor 85a | 31 | 4.2 | 4 | G7AC_BREDI (Q9L5D6) Glutaryl-7-aminocephalosporanic-acid acylase... | 30 | 9.4 |
|---|
>T2M4_METJA (Q58723) Type II restriction enzyme MjaIV (EC 3.1.21.4)| (Endonuclease MjaIV) (R.MjaIV) Length = 245 Score = 31.6 bits (70), Expect = 2.5 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 484 LKQYNV*ESNFKISPLEPRGLIGFTLRRHTPFEIVCDRI--GTHFLHF 621 LK Y + E N KI EP+ I R TP++++C I G +FL F Sbjct: 47 LKDYTISEENLKIKFSEPKDEIYSYEGRRTPYDLLCYGIINGKNFLIF 94
>TFR1_MOUSE (Q62351) Transferrin receptor protein 1 (TfR1) (TR) (TfR) (Trfr)| Length = 763 Score = 30.8 bits (68), Expect = 4.2 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 3/90 (3%) Frame = +1 Query: 403 IKNKFHKFSFTNVQKLI*VIKICVWFHLKQ--YNV*ESNFKISPLE-PRGLIGFTLRRHT 573 I+N+FH+F F+ V + +KI V + Q + +SN + P+E P G + F+ Sbjct: 171 IENQFHEFKFSKVWRDEHYVKIQVKSSIGQNMVTIVQSNGNLDPVESPEGYVAFSKPTEV 230 Query: 574 PFEIVCDRIGTHFLHFXLVLSVTCAISSVR 663 ++V GT L SV ++ VR Sbjct: 231 SGKLVHANFGTKKDFEELSYSVNGSLVIVR 260
>GR85A_DROME (Q8INM9) Putative gustatory receptor 85a| Length = 397 Score = 30.8 bits (68), Expect = 4.2 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -2 Query: 365 HTFQLFYSTLEKLSTYFDYFIQIHKSTL-*ISYFTYTRLLFQLFKKNTSSNYSTQ 204 H F + TL+ L + D+F I STL +++FTY L+F + S Y Q Sbjct: 64 HNFAVISLTLKFLFDFTDHFKYIESSTLITVNFFTYFTLVFFALLSSMGSCYQWQ 118
>G7AC_BREDI (Q9L5D6) Glutaryl-7-aminocephalosporanic-acid acylase precursor (EC| 3.5.1.93) (Glutaryl-7-ACA-acylase) (7-beta-(4-carboxybutanamido)cephalosporanic acid acylase) Length = 720 Score = 29.6 bits (65), Expect = 9.4 Identities = 8/35 (22%), Positives = 24/35 (68%) Frame = -3 Query: 295 IKVHFELVISHTLDSYSSYLRKIQVPTIPLNFREK 191 ++ +F+++ +H+ D Y + + ++QVPT + + ++ Sbjct: 348 LEQYFDMITAHSFDDYEAAMARMQVPTFNIVYADR 382 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,292,707 Number of Sequences: 219361 Number of extensions: 2004048 Number of successful extensions: 3852 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3852 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7082949625 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)