| Clone Name | rbags9j03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (E... | 59 | 1e-08 | 2 | UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrola... | 57 | 5e-08 | 3 | UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC ... | 52 | 2e-06 | 4 | HSP83_ANOGA (Q7PT10) Heat shock protein 83 | 33 | 0.43 | 5 | CO6_RAT (Q811M5) Complement component C6 precursor | 31 | 2.8 |
|---|
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 58.5 bits (140), Expect = 1e-08 Identities = 37/94 (39%), Positives = 51/94 (54%), Gaps = 6/94 (6%) Frame = -1 Query: 540 VVHFFKDNQHIQYYGVPFFFLIREGEALSDIKLRIQKKFEVPDEQFLKWKFAYV---AYN 370 V HFFKD + + +PF+F++ GE L D+K R+QK+ D QF K K A + ++ Sbjct: 1026 VQHFFKDLSRL--HDIPFYFVLLRGETLKDLKKRLQKRLGYNDTQFSKVKLAVLQAQSFG 1083 Query: 369 RPDYLQDSDIVLSRFQKNIYGAWEQS---LGLEH 277 +P YL D D VL YG E LGL+H Sbjct: 1084 KPYYLTDDDEVL-------YGELEPQSHILGLDH 1110
>UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrolase 5 (EC| 3.1.2.15) (Ubiquitin thioesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) Length = 1108 Score = 56.6 bits (135), Expect = 5e-08 Identities = 37/105 (35%), Positives = 53/105 (50%), Gaps = 2/105 (1%) Frame = -1 Query: 561 PRDRLVHVVHFFKDNQHIQYYGVPFFFLIREGEALSDIKLRIQKKFEVPDEQFLKWKFAY 382 P +++V V HF KD I +G+PF F+I+ E D KLR+ + + P+ F KF Sbjct: 1000 PEEKIVQVHHFHKDIARI--HGIPFSFVIKPQEKFIDTKLRLAARTQYPESIFSVIKFCV 1057 Query: 381 VAY--NRPDYLQDSDIVLSRFQKNIYGAWEQSLGLEHSDMPSKKP 253 V + NR YL D DI +K +L L+ + SKKP Sbjct: 1058 VDFDNNRVVYLNDEDITYDVVEK-----LNGTLALDRAKKDSKKP 1097
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 51.6 bits (122), Expect = 2e-06 Identities = 37/124 (29%), Positives = 63/124 (50%), Gaps = 5/124 (4%) Frame = -1 Query: 555 DRLVHVVHFFKDNQHIQYYGVPFFFLIREGEALSDIKLRIQKKFEVPDEQFLKWKFAYVA 376 + LV V HF K+ +G+PF I +GE ++ RIQ ++ +++F K+KFA V Sbjct: 987 EMLVTVAHFHKEV--FGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFKFAIVM 1044 Query: 375 YNRPDYLQDS--DIVLSRF--QKNIYGAWEQSLGLEHSDMPSKKPYMANQNRHSF-EKPV 211 R Y+ + ++ L F Q LGL+H + K+ +R+++ EK + Sbjct: 1045 TGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKR------SRYTYLEKAI 1098 Query: 210 KIYN 199 KI+N Sbjct: 1099 KIHN 1102
>HSP83_ANOGA (Q7PT10) Heat shock protein 83| Length = 689 Score = 33.5 bits (75), Expect = 0.43 Identities = 25/95 (26%), Positives = 42/95 (44%), Gaps = 3/95 (3%) Frame = -1 Query: 519 NQHIQYYGVPFFFLIREGEALSDIKLRIQKKFEV---PDEQFLKWKFAYVAYNRPDYLQD 349 N+H Q+ G P L+ + E D K + +K +V DE+ K K + N D Q+ Sbjct: 198 NKHSQFIGYPIKLLVEDAEDDEDKKDKKKKTVKVKYTEDEELNKTKPIWTR-NADDISQE 256 Query: 348 SDIVLSRFQKNIYGAWEQSLGLEHSDMPSKKPYMA 244 F K++ WE L ++H + + + A Sbjct: 257 E---YGEFYKSLTNDWEDHLAVKHFSVEGQLDFRA 288
>CO6_RAT (Q811M5) Complement component C6 precursor| Length = 934 Score = 30.8 bits (68), Expect = 2.8 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 11/61 (18%) Frame = +3 Query: 132 QCYSCPFVSRNHQVGTENITIFSCRS----------SPAFQKNG-DSGWPCMVFWRACLS 278 QC CP R GTE + + C+S SP ++ N D W C W AC + Sbjct: 522 QCAPCPNNGRPRLSGTECLCV--CQSGTYGENCEKRSPDYKSNAVDGNWGCWSSWSACNA 579 Query: 279 A 281 A Sbjct: 580 A 580 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,228,740 Number of Sequences: 219361 Number of extensions: 1907516 Number of successful extensions: 4291 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4290 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)