| Clone Name | rbags8p19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y209_ENCCU (Q8SWH3) Hypothetical protein ECU02_0090 | 33 | 0.92 | 2 | TECTA_HUMAN (O75443) Alpha-tectorin precursor | 30 | 4.6 | 3 | ECH12_MYCLE (P53526) Probable enoyl-CoA hydratase echA12 (EC 4.2... | 30 | 6.0 |
|---|
>Y209_ENCCU (Q8SWH3) Hypothetical protein ECU02_0090| Length = 258 Score = 32.7 bits (73), Expect = 0.92 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 10/85 (11%) Frame = -1 Query: 505 IKESTLVYL*CLFIQVSIFSQLV---------DIFLY-IVGGSIKLNSSSYSYIKCFFIT 356 I STL+ L F+ ++IFS + D+F Y I+ S + + C FIT Sbjct: 87 ILHSTLIVLLLAFVIINIFSSITFVTDKWNSEDLFFYSIILPSFFIPPTYLLSTSCDFIT 146 Query: 355 SSFYTTLTSSIMDIFCDLKLLISVL 281 +SF T++ ++I DL +L+S L Sbjct: 147 TSF----TATGINILVDLMILLSYL 167
>TECTA_HUMAN (O75443) Alpha-tectorin precursor| Length = 2155 Score = 30.4 bits (67), Expect = 4.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 73 ARTDXNCTIXXMAHLLTMEFIPLSYET*VQKFLC 174 ARTD +C + H LT + P ++T LC Sbjct: 1094 ARTDASCIVSGYGHYLTFDGFPFDFQTSCPLILC 1127
>ECH12_MYCLE (P53526) Probable enoyl-CoA hydratase echA12 (EC 4.2.1.17)| Length = 294 Score = 30.0 bits (66), Expect = 6.0 Identities = 16/70 (22%), Positives = 34/70 (48%) Frame = +1 Query: 70 IARTDXNCTIXXMAHLLTMEFIPLSYET*VQKFLCCVDLNVPSRHHRHLLTTFLATEKET 249 +++TD +CTI + + + + L + + + + LN P R + L + ++ Sbjct: 1 MSQTDASCTIAELPYRSVTDLVVLDFP---RPEVALITLNRPGRMNSMALDLMKSLKQVL 57 Query: 250 KQKTLDHDIR 279 K+ T DH +R Sbjct: 58 KRITYDHSVR 67 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,392,807 Number of Sequences: 219361 Number of extensions: 1416187 Number of successful extensions: 2462 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2408 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2462 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)