| Clone Name | rbags9d21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VCLA_GOSHI (P09799) Vicilin GC72-A precursor (Alpha-globulin A) | 41 | 0.006 | 2 | VCLB_GOSHI (P09801) Vicilin C72 precursor (Alpha-globulin B) | 39 | 0.028 | 3 | LHX8_MOUSE (O35652) LIM/homeobox protein Lhx8 (LIM homeodomain L... | 33 | 1.5 | 4 | MST2_DROHY (Q08696) Axoneme-associated protein mst101(2) | 32 | 2.0 | 5 | VCL_THECC (Q43358) Vicilin precursor | 32 | 3.4 | 6 | ADA19_HUMAN (Q9H013) ADAM 19 precursor (EC 3.4.24.-) (A disinteg... | 30 | 7.6 |
|---|
>VCLA_GOSHI (P09799) Vicilin GC72-A precursor (Alpha-globulin A)| Length = 605 Score = 40.8 bits (94), Expect = 0.006 Identities = 24/94 (25%), Positives = 39/94 (41%), Gaps = 1/94 (1%) Frame = -1 Query: 711 PGQGKEQCVQQCMRYGXNLXXXXXXXVIERPHAEEVEVDDQSNDSCDHKCQ-HHKVPARK 535 P + + C Q C + L E+ ++ + D+ C +CQ + P RK Sbjct: 80 PQRRYQDCRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQWQEQRPERK 139 Query: 534 KQCVDECHRREHHHPSRAACERKCSHWRDPTRKE 433 +QCV EC + P + E K WR+ +E Sbjct: 140 QQCVKECREQYQEDPWKGERENK---WREEEEEE 170 Score = 30.8 bits (68), Expect = 5.8 Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 7/61 (11%) Frame = -1 Query: 576 CDHKCQHHKVPAR---KKQCVDECHRREHHHPSRA--ACERKCSHWRD--PTRKERCVQT 418 C CQ + R ++ C ++ +++ P + C+++C W++ P RK++CV+ Sbjct: 87 CRQHCQQEERRLRPHCEQSCREQYEKQQQQQPDKQFKECQQRCQ-WQEQRPERKQQCVKE 145 Query: 417 C 415 C Sbjct: 146 C 146
>VCLB_GOSHI (P09801) Vicilin C72 precursor (Alpha-globulin B)| Length = 588 Score = 38.5 bits (88), Expect = 0.028 Identities = 22/82 (26%), Positives = 35/82 (42%) Frame = -1 Query: 711 PGQGKEQCVQQCMRYGXNLXXXXXXXVIERPHAEEVEVDDQSNDSCDHKCQHHKVPARKK 532 P + E+C Q+C + ++R E+ + Q + H Q + P RK+ Sbjct: 83 PQRRYEECQQECRQQEERQRPQCQQRCLKRFEQEQQQSQRQFQECQQHCHQQEQRPERKQ 142 Query: 531 QCVDECHRREHHHPSRAACERK 466 QCV EC R +P R E + Sbjct: 143 QCVRECRERYQENPWRREREEE 164 Score = 30.0 bits (66), Expect = 10.0 Identities = 20/102 (19%), Positives = 41/102 (40%), Gaps = 7/102 (6%) Frame = -1 Query: 699 KEQCVQQCM-RYGXNLXXXXXXXVIERPHAEEVEVDDQSNDSCDHKCQHHKVPARKKQCV 523 ++QC + C +YG ++ E + + C +C+ + ++ QC Sbjct: 58 QQQCEESCKSQYGEK----------DQQQRHRPEDPQRRYEECQQECRQQE-ERQRPQCQ 106 Query: 522 DECHRREHHHPSRAA-----CERKCSHWRD-PTRKERCVQTC 415 C +R ++ C++ C P RK++CV+ C Sbjct: 107 QRCLKRFEQEQQQSQRQFQECQQHCHQQEQRPERKQQCVREC 148
>LHX8_MOUSE (O35652) LIM/homeobox protein Lhx8 (LIM homeodomain Lhx7) (L3)| Length = 367 Score = 32.7 bits (73), Expect = 1.5 Identities = 17/59 (28%), Positives = 27/59 (45%) Frame = +1 Query: 55 SSCGKHT*QTNLLKEGKGTEFHGALF*ERHRQSCCYCKLLVFYSHAFAVIASKTYTRAY 231 S CG+H T+ ++ KG +H A F +C CK + FA++ K R + Sbjct: 158 SRCGRHIHSTDWVRRAKGNVYHLACF------ACFSCKRQLSTGEEFALVEEKVLCRVH 210
>MST2_DROHY (Q08696) Axoneme-associated protein mst101(2)| Length = 1391 Score = 32.3 bits (72), Expect = 2.0 Identities = 13/56 (23%), Positives = 26/56 (46%) Frame = -1 Query: 576 CDHKCQHHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDPTRKERCVQTCMR 409 C+ + + K A KK+C +E +RE + C ++ T K++C + + Sbjct: 1112 CEERAKKEKEAAEKKRC-EEAAKREKEAAEKKKCAEAAKKEKEATEKQKCAEAAKK 1166 Score = 32.3 bits (72), Expect = 2.0 Identities = 19/92 (20%), Positives = 36/92 (39%) Frame = -1 Query: 684 QQCMRYGXNLXXXXXXXVIERPHAEEVEVDDQSNDSCDHKCQHHKVPARKKQCVDECHRR 505 +QC L E +E E ++ C+ + + K A KKQC +E ++ Sbjct: 1062 KQCEERAKKLKEAAEKKQCEERAKKEKEAAEKKQ--CEERAKKLKEAAEKKQC-EERAKK 1118 Query: 504 EHHHPSRAACERKCSHWRDPTRKERCVQTCMR 409 E + CE ++ K++C + + Sbjct: 1119 EKEAAEKKRCEEAAKREKEAAEKKKCAEAAKK 1150 Score = 30.0 bits (66), Expect = 10.0 Identities = 16/69 (23%), Positives = 29/69 (42%) Frame = -1 Query: 615 AEEVEVDDQSNDSCDHKCQHHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDPTRK 436 A + E + C+ ++ K A KK+C E ++E R CE + K Sbjct: 418 AAKKEKEAAERKKCEELAKNIKKAAEKKKC-KEAAKKEKEAAERKKCEELAKKIKKAAEK 476 Query: 435 ERCVQTCMR 409 ++C +T + Sbjct: 477 KKCEETAKK 485
>VCL_THECC (Q43358) Vicilin precursor| Length = 525 Score = 31.6 bits (70), Expect = 3.4 Identities = 20/104 (19%), Positives = 37/104 (35%), Gaps = 10/104 (9%) Frame = -1 Query: 711 PGQGKEQCVQQCMRYGXNLXXXXXXXVIERPHAEEVEVDDQSNDSCDHKC---------- 562 P Q EQC ++C E +++ + C+ +C Sbjct: 38 PRQQYEQCQRRC---------------------ESEATEEREQEQCEQRCEREYKEQQRQ 76 Query: 561 QHHKVPARKKQCVDECHRREHHHPSRAACERKCSHWRDPTRKER 430 Q ++ + +QC C ++ + C+RKC W +ER Sbjct: 77 QEEELQRQYQQCQGRCQEQQQGQREQQQCQRKC--WEQYKEQER 118
>ADA19_HUMAN (Q9H013) ADAM 19 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 19) (Meltrin beta) (Metalloprotease and disintegrin dentritic antigen marker) (MADDAM) Length = 956 Score = 30.4 bits (67), Expect = 7.6 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +2 Query: 98 KEKEQSSMELSSRRGIANHAATASYWSFILTPLPS*LARRIRGRIYRSVYTR 253 +E E SS+ LS+ RGI +S S+++ PLP + + IYRS + + Sbjct: 121 RETELSSVTLSTCRGIRGLITVSSNLSYVIEPLPDSKGQHL---IYRSEHLK 169 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,198,804 Number of Sequences: 219361 Number of extensions: 1713282 Number of successful extensions: 4634 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4621 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 9839353125 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)