| Clone Name | rbags8o10 |
|---|---|
| Clone Library Name | barley_pub |
>PSD13_HUMAN (Q9UNM6) 26S proteasome non-ATPase regulatory subunit 13 (26S| proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) Length = 376 Score = 91.7 bits (226), Expect = 1e-18 Identities = 42/94 (44%), Positives = 65/94 (69%) Frame = -1 Query: 595 FSRPSEDRTIPLSVIAKQTKLSTSEVECLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVL 416 F+RP+ R + IAK K++ +EVE L+MK+LSV L++G IDEVD VH++WVQPRVL Sbjct: 282 FTRPANHRQLTFEEIAKSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVL 341 Query: 415 GIPQVKALRERLDSWVGKVHSTLLSIEAETPDLV 314 + Q+K +++RL+ W V S + +E + D++ Sbjct: 342 DLQQIKGMKDRLEFWCTDVKSMEMLVEHQAHDIL 375
>PSD13_CHICK (P84169) 26S proteasome non-ATPase regulatory subunit 13 (26S| proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) Length = 376 Score = 91.7 bits (226), Expect = 1e-18 Identities = 42/94 (44%), Positives = 65/94 (69%) Frame = -1 Query: 595 FSRPSEDRTIPLSVIAKQTKLSTSEVECLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVL 416 F+RP+ R + IAK K++ +EVE L+MK+LSV L++G IDEVD VH++WVQPRVL Sbjct: 282 FTRPANHRQLTFEEIAKSAKVTVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVL 341 Query: 415 GIPQVKALRERLDSWVGKVHSTLLSIEAETPDLV 314 + Q+K +++RL+ W V S + +E + D++ Sbjct: 342 DLQQIKGMKDRLEFWCTDVRSMEMLVEHQAHDIL 375
>PSD13_BOVIN (Q5E964) 26S proteasome non-ATPase regulatory subunit 13 (26S| proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) Length = 376 Score = 90.5 bits (223), Expect = 3e-18 Identities = 41/94 (43%), Positives = 65/94 (69%) Frame = -1 Query: 595 FSRPSEDRTIPLSVIAKQTKLSTSEVECLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVL 416 F+RP+ R + IA+ K++ +EVE L+MK+LSV L++G IDEVD VH++WVQPRVL Sbjct: 282 FTRPANHRQLTFEEIARSAKITVNEVELLVMKALSVGLVKGSIDEVDKRVHMTWVQPRVL 341 Query: 415 GIPQVKALRERLDSWVGKVHSTLLSIEAETPDLV 314 + Q+K +++RL+ W V S + +E + D++ Sbjct: 342 DLQQIKGMKDRLEFWCTDVKSMEMLVEHQAHDIL 375
>PSD13_MOUSE (Q9WVJ2) 26S proteasome non-ATPase regulatory subunit 13 (26S| proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5) Length = 376 Score = 90.1 bits (222), Expect = 4e-18 Identities = 41/94 (43%), Positives = 64/94 (68%) Frame = -1 Query: 595 FSRPSEDRTIPLSVIAKQTKLSTSEVECLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVL 416 F+RP+ R + IAK K++ ++VE L+MK+LSV L+ G IDEVD VH++WVQPRVL Sbjct: 282 FTRPANHRQLTFEEIAKSAKITVNKVELLVMKALSVGLVRGSIDEVDKRVHMTWVQPRVL 341 Query: 415 GIPQVKALRERLDSWVGKVHSTLLSIEAETPDLV 314 + Q+K +++RL+ W V S + +E + D++ Sbjct: 342 DLQQIKGMKDRLELWCTDVKSMEMLVEHQAQDIL 375
>RPN9_SCHPO (Q9US13) Probable 26S proteasome regulatory subunit rpn9| Length = 381 Score = 66.2 bits (160), Expect = 7e-11 Identities = 32/75 (42%), Positives = 47/75 (62%) Frame = -1 Query: 595 FSRPSEDRTIPLSVIAKQTKLSTSEVECLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVL 416 F P RT+ IA+ T++ ++EVE L+M++LSV LI G+IDEV V +S VQ R+L Sbjct: 287 FQLPPNQRTLTFDTIARATRIPSNEVELLIMRALSVGLITGVIDEVTQIVTISSVQSRIL 346 Query: 415 GIPQVKALRERLDSW 371 Q+ ++ RL W Sbjct: 347 NHSQIASMESRLREW 361
>RPN9_YEAST (Q04062) 26S proteasome regulatory subunit RPN9 (Proteasome| non-ATPase subunit 7) Length = 393 Score = 59.3 bits (142), Expect = 8e-09 Identities = 29/81 (35%), Positives = 49/81 (60%) Frame = -1 Query: 574 RTIPLSVIAKQTKLSTSEVECLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVLGIPQVKA 395 R + I+K T L VE L+M+++S+ L++G ID+V+ V +SWVQPR++ Q+ Sbjct: 306 RMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITK 365 Query: 394 LRERLDSWVGKVHSTLLSIEA 332 +++RL W +V +EA Sbjct: 366 MKDRLVEWNDQVEKLGKKMEA 386
>CSN7A_SCHPO (Q9UUJ7) COP9 signalosome complex subunit 7A| Length = 205 Score = 40.0 bits (92), Expect = 0.005 Identities = 19/71 (26%), Positives = 38/71 (53%) Frame = -1 Query: 529 TSEVECLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVLGIPQVKALRERLDSWVGKVHST 350 T VE +M+++ ++ G I+ T+HVSW R L ++ ++ LD ++ + + Sbjct: 101 TFTVEYYIMQAMMNQILVGKINAKTQTLHVSWALERFLDSKRIDEMKYSLDRFIERCSNI 160 Query: 349 LLSIEAETPDL 317 L ++A TP + Sbjct: 161 LFQLDAGTPSV 171
>CSN7B_SCHPO (Q09722) COP9 signalosome complex subunit 7B| Length = 402 Score = 37.0 bits (84), Expect = 0.043 Identities = 21/81 (25%), Positives = 39/81 (48%) Frame = -1 Query: 577 DRTIPLSVIAKQTKLSTSEVECLLMKSLSVHLIEGIIDEVDSTVHVSWVQPRVLGIPQVK 398 + T+ +AK K+ +EVE ++ + L+EG + ++ T+ + RV G + Sbjct: 297 NNTLSYGDVAKSLKIDENEVELWIIDVIRAGLVEGRMSQLTKTLSIHRSSYRVFGKHEWV 356 Query: 397 ALRERLDSWVGKVHSTLLSIE 335 AL E+L W + L +E Sbjct: 357 ALHEKLAKWGSSLRYMLQVME 377
>SYFB_DEHSC (Q3ZZD2) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 809 Score = 30.8 bits (68), Expect = 3.1 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 107 DFSVSIRDDRSKLQVQINRTPKATRFSLSRKEQLARAAQPDGLSFYTAAC 256 DF + D + K++++IN + TR++ S E + PD L AC Sbjct: 195 DFKATGPDIKEKIEIEINNSKLCTRYTASLIEGIKLGESPDWLKERLIAC 244
>RECF_ERWCT (Q6CYR6) DNA replication and repair protein recF| Length = 361 Score = 30.4 bits (67), Expect = 4.0 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Frame = +2 Query: 236 SFYTAAC*EPKPAYSEAFLAKKKLSRHE---IRGLCLDGQQRAMHFADPRVQPLTQRLHL 406 +F C +P + A+ K+L R +R + GQ RA D + PL +R+ Sbjct: 134 AFLDWGCFHNEPGFFAAWSNMKRLQRQRNAALRQVSHYGQLRAW---DQELVPLAERISE 190 Query: 407 WDAEYSGLDPRDV 445 W A+YS D+ Sbjct: 191 WRAQYSAAIANDI 203
>B3A2_CAVPO (Q9Z0S8) Anion exchange protein 2 (Non-erythroid band 3-like| protein) (AE2 anion exchanger) (Solute carrier family 4 member 2) Length = 1238 Score = 30.4 bits (67), Expect = 4.0 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 5/84 (5%) Frame = +3 Query: 108 ISLFQSVMTEASYKS-----RSIGHPRQQGFRYPEKSS*HAQHSQMVSRFTPPPAENQSL 272 + F+ ++ EA + RS G ++ F Y +SS H H +S PP A + Sbjct: 44 VERFEEILQEAGSRGGEELGRSYG---EEDFEYHRQSSHHIHHP--LSTHLPPDARRRKT 98 Query: 273 PIQKHFWPRRS*AATRSGVSASMD 344 P + PRR AT +G + +++ Sbjct: 99 PQGQVRKPRRRPGATPAGETPTIE 122
>SYFB_DEHE1 (Q3Z9I7) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 809 Score = 30.4 bits (67), Expect = 4.0 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +2 Query: 107 DFSVSIRDDRSKLQVQINRTPKATRFSLSRKEQLARAAQPDGLSFYTAAC 256 DF + +D + K+ ++I T TR++ S E + PD L AC Sbjct: 195 DFKATGKDIKDKINIEIKNTKLCTRYTASLIEGIKIGESPDWLKERLIAC 244
>TAF1C_RAT (Q6P773) TATA box-binding protein-associated factor, RNA polymerase| I, subunit C (TATA box-binding protein-associated factor 1C) (TBP-associated factor 1C) Length = 842 Score = 29.6 bits (65), Expect = 6.9 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +1 Query: 304 AKPPRDQGSLPRWTTACYALC 366 A PP DQGS P WT+ A C Sbjct: 592 AAPPVDQGSTPSWTSRASARC 612
>NCOA1_MOUSE (P70365) Nuclear receptor coactivator 1 (EC 2.3.1.48) (NCoA-1)| (Steroid receptor coactivator 1) (SRC-1) (Nuclear receptor coactivator protein 1) (mNRC-1) Length = 1447 Score = 29.3 bits (64), Expect = 9.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 371 PRVQPLTQRLHLWDAEYSGLDPRD 442 P +QP +H+ D E+SGL P+D Sbjct: 352 PDMQPFIMGIHIIDREHSGLSPQD 375
>NCOA1_HUMAN (Q15788) Nuclear receptor coactivator 1 (EC 2.3.1.48) (NCoA-1)| (Steroid receptor coactivator 1) (SRC-1) (RIP160) (Protein Hin-2) (NY-REN-52 antigen) Length = 1441 Score = 29.3 bits (64), Expect = 9.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 371 PRVQPLTQRLHLWDAEYSGLDPRD 442 P +QP +H+ D E+SGL P+D Sbjct: 352 PDMQPFIMGIHIIDREHSGLSPQD 375
>VGLG_TRTV (P33495) Major surface glycoprotein G (Attachment glycoprotein G)| Length = 391 Score = 29.3 bits (64), Expect = 9.0 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = +3 Query: 171 RQQGFRYPEKSS*HAQHSQMVSRFTPPPAENQSLPIQKHFWPRRS*AATRSGVSASMDNS 350 R+ G S+ + QH++ R TPPP+ + + I +H P +T + + S Sbjct: 246 REPGPTNQPNSTTNGQHNKHTQRMTPPPSHDNTRTILQHTTPWEKTFSTYKPTHSPTNES 305 Query: 351 VLCTLPTHESS 383 +LPT ++S Sbjct: 306 DQ-SLPTTQNS 315
>AMPM_HELVI (Q11000) Membrane alanyl aminopeptidase precursor (EC 3.4.11.-)| (Aminopeptidase N-like protein) (CryIA(C) receptor) (BTBP1) Length = 1009 Score = 29.3 bits (64), Expect = 9.0 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = -1 Query: 439 SWVQPRVLGIPQVKALRERLDSWVGKVHSTLLSIEAE 329 +W++ R++G PQ+ L E++ W KV L + E Sbjct: 694 NWLRNRLVGKPQLDELNEKIVQWSSKVMGELTYMPTE 730 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,771,146 Number of Sequences: 219361 Number of extensions: 1653720 Number of successful extensions: 4307 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 4186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4307 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)