| Clone Name | rbags8o07 |
|---|---|
| Clone Library Name | barley_pub |
>SEM5B_HUMAN (Q9P283) Semaphorin-5B precursor| Length = 1093 Score = 31.2 bits (69), Expect = 1.3 Identities = 17/41 (41%), Positives = 24/41 (58%) Frame = +3 Query: 177 LNYQT*KANSPSRCSYLPQN*SGSVISRVFESYTITVLQFA 299 L+ T K N +RC Y P++ S +VIS E Y TV+ F+ Sbjct: 158 LSRTTEKINGVARCPYDPRHNSTAVISSQGELYAATVIDFS 198
>RPA9_YEAST (P32529) DNA-directed RNA polymerase I 13.7 kDa polypeptide (EC| 2.7.7.6) (A12.2) Length = 125 Score = 30.0 bits (66), Expect = 2.9 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -3 Query: 415 INDVLIXKGPCPNCGTENLSFYGTILSIESGGATNNVKCANC 290 + D K CP CG E ++++ L GAT C +C Sbjct: 76 LKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSC 117
>SEM5B_MOUSE (Q60519) Semaphorin-5B precursor (Semaphorin G) (Sema G)| Length = 1093 Score = 30.0 bits (66), Expect = 2.9 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 195 KANSPSRCSYLPQN*SGSVISRVFESYTITVLQFA 299 K N +RC Y P++ S +VIS E Y TV+ F+ Sbjct: 164 KINGVARCPYDPRHNSTAVISSQGELYAATVIDFS 198
>RS27_SULTO (Q973F9) 30S ribosomal protein S27e| Length = 66 Score = 29.6 bits (65), Expect = 3.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 385 CPNCGTENLSFYGTILSIESGGATNNVKCANCKTVMVY 272 CPNCG E F AT V+C +C T +VY Sbjct: 21 CPNCGNEQTVF---------SHATFPVRCLSCGTQLVY 49
>RS27_SULSO (Q97Z80) 30S ribosomal protein S27e| Length = 66 Score = 29.6 bits (65), Expect = 3.8 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 385 CPNCGTENLSFYGTILSIESGGATNNVKCANCKTVMVY 272 CPNCG E F AT V+C +C T +VY Sbjct: 21 CPNCGNEQTIF---------SHATFPVRCLSCGTELVY 49
>RPA12_MACMU (Q5TM50) DNA-directed RNA polymerase I subunit 12 (EC 2.7.7.6)| (Nuclear RNA polymerase I small specific subunit Rpa12) (Zinc ribbon domain-containing protein 1) Length = 126 Score = 28.9 bits (63), Expect = 6.4 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 385 CPNCGTENLSFYGTILSIESGGATNNVKCANCK 287 CP CG E ++++ + G T C NCK Sbjct: 87 CPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCK 119
>RPA12_HUMAN (Q9P1U0) DNA-directed RNA polymerase I subunit 12 (EC 2.7.7.6)| (Nuclear RNA polymerase I small specific subunit Rpa12) (Zinc ribbon domain-containing protein 1) Length = 126 Score = 28.9 bits (63), Expect = 6.4 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 385 CPNCGTENLSFYGTILSIESGGATNNVKCANCK 287 CP CG E ++++ + G T C NCK Sbjct: 87 CPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCK 119
>RGYR1_SULTO (Q971T7) Reverse gyrase 1 [Includes: Helicase (EC 3.6.1.-);| Topoisomerase (EC 5.99.1.3)] Length = 1156 Score = 28.9 bits (63), Expect = 6.4 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 6/71 (8%) Frame = -3 Query: 454 LILVTAQVVTKAIINDVLIXKGPCPNCGTENLSFYGTILSIESGGATNNV------KCAN 293 +ILV ++ +I +++ KG + TEN+ +YG +E G N KC N Sbjct: 609 IILVNDEI----LITNIIATKGHITDLTTENIGYYG----VEVGNNEFNAYYSPIYKCYN 660 Query: 292 CKTVMVYDSKT 260 C S T Sbjct: 661 CGKTFTIKSNT 671
>RPA12_MOUSE (Q791N7) DNA-directed RNA polymerase I subunit 12 (EC 2.7.7.6)| (Nuclear RNA polymerase I small specific subunit Rpa12) (Zinc ribbon domain-containing protein 1) Length = 123 Score = 28.5 bits (62), Expect = 8.4 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -3 Query: 385 CPNCGTENLSFYGTILSIESGGATNNVKCANCK 287 CP CG E ++++ + G T C NCK Sbjct: 84 CPRCGHEGMAYHTRQMRSADEGQTVFYTCINCK 116 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,856,333 Number of Sequences: 219361 Number of extensions: 1017524 Number of successful extensions: 2353 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2278 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2351 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)