| Clone Name | rbags8n18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RLUB_XANCP (Q8P8M6) Ribosomal large subunit pseudouridine syntha... | 35 | 0.097 | 2 | Y554_AQUAE (O66829) Hypothetical RNA pseudouridine synthase aq_5... | 33 | 0.48 | 3 | POL_HTL1C (P14078) Pol polyprotein [Contains: Reverse transcript... | 30 | 4.1 | 4 | POL_HTL1A (P03362) Pol polyprotein [Contains: Reverse transcript... | 30 | 4.1 | 5 | YQ38_CAEEL (Q09459) Hypothetical protein C09G5.8 | 30 | 4.1 |
|---|
>RLUB_XANCP (Q8P8M6) Ribosomal large subunit pseudouridine synthase B (EC| 5.4.99.-) (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B) Length = 492 Score = 35.4 bits (80), Expect = 0.097 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = -3 Query: 527 VRELVQNAGLKVYALKRVRIGRFRLPSDLGIGKMVELKEADIKAL 393 VR L ++ G +V LKR R G+ LP +L G+ VEL + + AL Sbjct: 223 VRRLWESQGCQVSRLKRTRYGKVSLPRELLRGQSVELAQEKVDAL 267
>Y554_AQUAE (O66829) Hypothetical RNA pseudouridine synthase aq_554 (EC| 5.4.99.-) (RNA-uridine isomerase) (RNA pseudouridylate synthase) Length = 238 Score = 33.1 bits (74), Expect = 0.48 Identities = 17/45 (37%), Positives = 25/45 (55%) Frame = -3 Query: 527 VRELVQNAGLKVYALKRVRIGRFRLPSDLGIGKMVELKEADIKAL 393 V+ L + G V LKR R+G RL ++ G+ EL E ++K L Sbjct: 184 VKRLFKAVGHNVVYLKRTRVGNLRLDENMEPGEWRELTEEEVKEL 228
>POL_HTL1C (P14078) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 896 Score = 30.0 bits (66), Expect = 4.1 Identities = 18/69 (26%), Positives = 33/69 (47%) Frame = +2 Query: 176 RSSPRVLRMKGMPVEPDRQAPISHL*WHNRRPFKRGVVMPYAGRGICYIHPPTPLSETEP 355 R+ P+ R + +P +P+R + HL R+ + G + PY G G + P + T Sbjct: 19 RTPPKAPRNQPVPFKPERLQALQHL---VRKALEAGHIEPYTGPGNNPVFPVKKANGTWR 75 Query: 356 MNSDVHSTS 382 D+ +T+ Sbjct: 76 FIHDLRATN 84
>POL_HTL1A (P03362) Pol polyprotein [Contains: Reverse| transcriptase/ribonuclease H (EC 2.7.7.49) (EC 3.1.26.4) (RT); Integrase (IN)] Length = 896 Score = 30.0 bits (66), Expect = 4.1 Identities = 18/69 (26%), Positives = 33/69 (47%) Frame = +2 Query: 176 RSSPRVLRMKGMPVEPDRQAPISHL*WHNRRPFKRGVVMPYAGRGICYIHPPTPLSETEP 355 R+ P+ R + +P +P+R + HL R+ + G + PY G G + P + T Sbjct: 19 RTPPKAPRNQPVPFKPERLQALQHL---VRKALEAGHIEPYTGPGNNPVFPVKKANGTWR 75 Query: 356 MNSDVHSTS 382 D+ +T+ Sbjct: 76 FIHDLRATN 84
>YQ38_CAEEL (Q09459) Hypothetical protein C09G5.8| Length = 1531 Score = 30.0 bits (66), Expect = 4.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 221 VQQACLSFEEHGGCFAEEHGSVCWSFGICSARL 123 ++ C+ FE CF +EHG C +AR+ Sbjct: 114 IETICIDFEHFSHCFIQEHGKYCGYRSEITARM 146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,574,723 Number of Sequences: 219361 Number of extensions: 1346085 Number of successful extensions: 3261 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3222 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3261 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)