| Clone Name | rbags8j11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SFRS4_HUMAN (Q08170) Splicing factor, arginine/serine-rich 4 (Pr... | 30 | 4.6 | 2 | GLMM_PROMP (Q7V349) Phosphoglucosamine mutase (EC 5.4.2.10) | 29 | 7.9 |
|---|
>SFRS4_HUMAN (Q08170) Splicing factor, arginine/serine-rich 4 (Pre-mRNA-splicing| factor SRP75) (SRP001LB) Length = 494 Score = 30.0 bits (66), Expect = 4.6 Identities = 18/50 (36%), Positives = 26/50 (52%) Frame = -1 Query: 507 SATSHDSKSRPKSEAGNANVEKLLSQMHDLSFMLKDELSIPSKSADRSES 358 S+ S SKSR +S +G+ + K S+ S K++ PSK RS S Sbjct: 210 SSKSSHSKSRSRSRSGSRSRSKSRSRSQSRSRSKKEKSRSPSKEKSRSRS 259
>GLMM_PROMP (Q7V349) Phosphoglucosamine mutase (EC 5.4.2.10)| Length = 452 Score = 29.3 bits (64), Expect = 7.9 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = +3 Query: 57 LITMWAQDL--SSLLTNGTNHQGKIAXILFRSM*QKIARILHRS 182 ++ +W ++L LLTN T K+A + F + +KI ILHR+ Sbjct: 257 ILFLWGRELLEEKLLTNNTIISTKMANLGFENTWKKIGGILHRT 300 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,239,702 Number of Sequences: 219361 Number of extensions: 1418613 Number of successful extensions: 3006 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3006 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)