| Clone Name | rbags8i21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YK25_YEAST (P36138) Hypothetical 21.1 kDa protein in GAP1-NAP1 i... | 28 | 5.5 | 2 | SIM1_MOUSE (Q61045) Single-minded homolog 1 (mSIM1) | 28 | 5.5 | 3 | GRIN1_MOUSE (Q3UNH4) G protein-regulated inducer of neurite outg... | 27 | 9.4 |
|---|
>YK25_YEAST (P36138) Hypothetical 21.1 kDa protein in GAP1-NAP1 intergenic| region Length = 191 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 216 RSLXTNYKALPXPPPHSLVDRSRVXDPXHSTXYTXHXP 329 R+ TN L PP S++DRSR P +++ T P Sbjct: 155 RTFETNSSVLAIPP-QSILDRSRTLPPSNASNTTTRRP 191
>SIM1_MOUSE (Q61045) Single-minded homolog 1 (mSIM1)| Length = 765 Score = 28.1 bits (61), Expect = 5.5 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +3 Query: 33 LQRQLVNLSAQKPTVKYTTAKSTTVIXKRNTTK 131 LQ L +SA KPT YT++ + T+ R K Sbjct: 340 LQLSLDQISASKPTFSYTSSSTPTISDNRKGAK 372
>GRIN1_MOUSE (Q3UNH4) G protein-regulated inducer of neurite outgrowth 1 (GRIN1)| Length = 932 Score = 27.3 bits (59), Expect = 9.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +3 Query: 216 RSLXTNYKALPXPPPHSLVDRSRVXDPXHST 308 R ++ KA+P PP H+L D+S DP H++ Sbjct: 2 RDCCSSPKAIPAPPRHAL-DQSLGMDPRHTS 31 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,898,659 Number of Sequences: 219361 Number of extensions: 428232 Number of successful extensions: 979 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 80,573,946 effective HSP length: 95 effective length of database: 59,734,651 effective search space used: 1433631624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)